Repbase Reports

2001, Volume 1, Issue 4
April 30, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 31

VANDAL20

Autonomous DNA transposon VANDAL20, a fossil.

Submitted:
30-Apr-2001
Accepted:
30-Apr-2001
Key Words:
Autonomous DNA transposon; MuDR superfamily; MuDR transposase; SUMO protease; VANDAL20
Source:
thale cress
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Charophyta/Embryophyta group; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
VANDAL20, a family of monstrous MuDR-like DNA transposons.
Journal:
Repbase Reports 1:(4) p.31 (2001)
Abstract:
VANDAL20 is a fossil of a MuDR-like autonomous DNA transposon. It has been active transpositionally relatively recently; its exon/intron structure is well preserved, and it is flanked by a perfect 9-bp target site duplication (TTAATTAAG). VANDAL20 has imperfect subterminal 52-bp inverted repeats (8 mismatches, positions 17-68 and 12704-12653). A 8790aa MuDR-like transposase, VANDAL20p1, is encoded by 4 exons (predicted by FGENESH and GENSCAN). CDS join(610..616,709..2656,2811..3405,3479..3568) VANDAL20p1: MEVDDIVVVQAGRWILYSTGEWEFKLDSCRHGRAMSLMGLRTLRDLELKVRHIFGLEKPS ISLELSYIFEDRLALLAGVLPGPTMIGSDWQFRCFKSLSIGDKSVNLFVCFREGDSVIVG PACEPRQTSASVVKYFEAGEPTFAGIVQFRDKPVPAVGGGYFAGLLSSVQDNMDAHPPNN HSDFVQSTTVCDLSSQWDISDELLLEALEAVEKSGAFVTAAGVDTSLPAEVPDSGDDSES LAESDESSSLSTGSDLEVSEFDDDTLHENTLQSDKEIVVHEDIGDDDFIEQPPKKKVLLQ NTNPGAMTEFLETCQKGISIDQVYGYEDLEPMFGDDDIDAKAAYVDLTKEDDNMFVGRTF ASREDFRIALSIYAINRIFRFKFTRYEKHYLVAECYDKKNCDWRVRAHQVGGDSEEYEVR LAKLEHVCKVQTRSRFSKHATSKVVAALLRAKYAKAFCGPRARDLPDSLLREHNVRMTYW KCWKAKELAVETAQGTDESSFSLLPVYLHVLQLANPGTVYHLETELDDIGDDRFKYVFLS LGASVKRLKYIRRVVVVDGTHLFGKYLGCLLTASCQDANFQIFPIAFAVVDSETDHSWTW FMNKLSEIIKDGPDLTFVSDRNQSIFKSVGLVFPQAHHGACLVHIRRNVKGRVHFTGERY NLMSSNIAESLNNALLPARGSPVVALLEFIRKMLARWFESRRKKISRTVGDIPIAVEREL MKRFKGALGMSVSAVGSWDFEVVAKDGEQFHVSLEQQSCSCLEFQAIRIPCTHAMAACHD RGLEFRTLVGEMHRLPMWSPTVQAPILLVRDPSEVKVPEEIRSLCLMPPKTKRPAGRPPK LRIHSVGEYEGNNKSKTPNKGGRCGGLGHNRVTCKTPLG A ~224-aa protein of unknown function is encoded by one or two exons in a region 4794-5464. X masks a short deletion reconstructed based on sequences of VANDAL20p2-like proteins encoded by different VANDALs. VANDAL20p2: MPDIPDDLLAKIVKLVADDRWWLLGPILKAGRRGRDMVYRDNVLKDACIYSLCSDPSDLY YFRNQDTDVVHQGRYRPFFERCLKAGNKTAIYYEGLRVVAEGCDLNGGIELLAQLVPEDG XGWRSMCLGNEAMAVHYLEQFGIFHAPLSTQRVRLWGEELVRDLRPYRRISHASYRKAFI YPLCKGIPSPDCAMDCALASSGYENFCNDCYLWWLSRKVCQMV VANDAL20p2 is 25% identical (blastp, E=3e-11) to VANDAL20p3, a 201-aa protein encoded by the second strand. CDS complement(join(6864..7457,7570..7581)) VANDAL20p3: MSLVKLGDDDAYYLAPVILTNKRGRDIALSRDIVKSANLTAFCLEPPKIYPGGVARSFFT RQALYYEALRLVTRERDIQGSLALLNELVPEDESATVAYAMFQMCAERGDLAGATFDMIF ESLGDRLLFNIYSEDLEAECEGLIDTLLAYEPANEDTFGPIWEFAYSKRINVPDCAYWHE GEHYCEGCYIFNAALRICEI VANDAL20's second strand encoded also a 958-aa protein called VANDAL20p4. CDS complement(join(8459..9082,9169..9252,9331..9585, 9664..9831,10128..10388,10477..10959,11102..11461, 11629..12033,12144..12269,12368..12466)) VANDAL20p4 (958 aa): MTKKKSSKSKTISPPVVMKQEPKRRNSRADAQRDTHAKSPAKSPASARGLRDESPISPAP AKIPAKSGGLRNESKQGDERCRDSEFTNPSLPCRLLHPSEFPDGGRLNIHSKPEYLGTLV ELLEGSEAWDELIASQFKKLFELPVARCHHSAKLIHGMLTRQLLTKNKHELWTVYGGFPL RFSIREFQMTTGLICDKLPSESKVEDYHDPAYLNRKQHRVTRDFVEMLHDIEFFLSYPWG RVSFESTMERFGPSAGEEDPIAELKARLSQKSSVCYGFPLALQLLVLKSVPALCSRIKDT VDFRNFIQKLFVDLGRTILLRESDVLDAEQTANLSVEYTLYQSETVKGDLSWPDEKEDEG VELIISLIKQKHHFKAETWPIHSIQCSSKDAPAADAEYVGVALDTDDVEFVGTRTVGPED KCEPSKAVKRAKKEYYPIRRKPFTRSSKKEGLNVEPLPTQDKAATPVGKTVHKKTAKQDA TLIKQAPLLSLLLMEKATETAAGAPETPKSKSKKKKETKQPVTRKRKREEVTSLSSGSSS SGLNHGPAVDTDIGVDGGGTVNLEGSVDPWELYGSTKNISEPQEMGRESPTSPVPTATQD KPMDTKPIKTMEEPLDLGNRAGSPRQTPCSPVTPIAQVIPDSSIVAVSPAYFEKERTNIR QPVPGKRVPIRSCFLDTTKYSVDPRISALFKSRTKEPAYTPLPKLDDGEFQTFKRLLEDD PQSEYTICTGHTVTNNHFLDIATKETWVNTEHMQLITGMLMKRRGKAYSQRRVAIIDTWF AMLLSTHYEDFQKCEDKAKYEWGKTIKGYITGKSTGIHMKSEFLKHVDVVYVPMNWGCSH WVGLVINLKQQSIDVLDSFISPTPEEAVEFQMTPIVSSCPTLTTEMTTEPFSCTRVTGLY DNKGDGDCGPVACKFLEMHAHGMDYTDMTALTDEVVIRIQKVYAMDTYAAFVEWEDEY C-terminal portion of VANDAL20p4 is similar to the SUMO-like protease, which is present in highly divergent forms in different VANDAL-like families. These proteases are functional elements of VANDALs that help them to multiply.
Derived:
Positions 104443 91724 Accession No AL161499 GenBank (rel. 126.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    VANDAL20, a family of monstrous MuDR-like DNA transposons.
    Direct submission (December 13, 2001)

© 2001-2019 - Genetic Information Research Institute