Repbase Reports

2001, Volume 1, Issue 4
April 30, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 17

ATMU11

A molecular fossil of the ATMU11 autonomous DNA transposon.

Submitted:
30-Apr-2001
Accepted:
30-Apr-2001
Key Words:
autonomous DNA transposon; MUDR superfamily; TIR; transposase; ATMU11
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Plantae; Embryobionta; Magnoliophyta; Magnoliopsida; Dilleniidae; Capparales; Brassicaceae
[1] Authors:
Kapitonov,V. and Jurka,J.
Title:
The ATMU11 family of MuDR-like transposons.
Journal:
Repbase Reports 1:(4) p.17 (2001)
Abstract:
ATMU11 is a fossil of an autonomous DNA transposon from the MuDR superfamily. ATMU11 is flanked by 90% identical ~240-bp TIRs. ATMU11 represents one of tens MuDR-like families present today in the A. thaliana genome. It is flanked by a 10-bp target site duplication. ATMU11 has preserved well the MuDr-like ATMU11p transposase. Presumably it was encoded originally by 4 exons. Exon 3 is currently damaged by a false stop codon at position 1848-1850. The stop codon is masked by X in the 743-aa ATMU11p protein sequence. CDS join (371..1237,1363..1590,1674..2648,2728..2889) ATMU11p: MTRRESKRKRPDEKEKRDVDPVREKNTESEAVSGDDCEVCGDEDCDDIRYDDEEDDRDEV NETEHRNRLGVDEQVCEDFVAEFGEAARDDEDVSDADSGDEIWDDERIPDPLSDSDNDED LVDGVARTEPEDLEELLKLGKTFSCPEDFKIAVLRYSLKTRYDIKLYRSQTLKIGAKCLD TDVKCQWRCYCSYDRKKHKMQIKVYESKHICVRSGYFKMLKRRTIAWLFSDRLRKNPKIT KHEMVDEIKREYNLVVSDEQCSKAKTKIMKERRAVHEDHFSRIWDYQAETCRPIIGVDGA FLNWDVKGHLLAATGRDGDNRLVPIAWAVVEIENDDNWDWFIRMLTTTLDLQDGSNVAII SDKQAGLVKAIHSILPNVEHRQCARHIMDNWKRNSHDMELQRMFWKIARSYTEGEYAANM EALXKYNPGAFSSLLRTHPMTWSRAFFRIGSCCNDNLNNLSESFKRTIRQARKKPLLDLL EDIRRQCMVRNEKRYVLAGRLKTRFTKRAHFEIEKMVEGSQFCIRWMARNNKHEISLNNV IYSVDMNDNTCGCRKWQMTGIPCVHAASVIIGKKQKVEDYVVDWYTTQRWQQTYKDGIAP VQGKILWPRVNRFGVLPPPWRRGNPGRPNNYARRKGRNEAASSSITTLSRLHRVMTCSNC KQEGHNKKGCKNQWVEGQPKRPRGRPKKASEPRNILFGQGLSHAFSGSQDQASQRSQSSQ TSHVSQRVPHGEGQGQGQGQYTY
Derived:
Positions 53477 57307 Accession No AC021666 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V. and Jurka,J.
    The ATMU11 family of MuDR-like transposons.
    Direct submission (December 05, 2001)

© 2001-2019 - Genetic Information Research Institute