Repbase Reports

2001, Volume 1, Issue 4
April 30, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 14

ATHILA8B_I

ATHILA8B_I is a an internal portion of the ATHILA8B endogenous retrovirus - a consensus sequence.

Submitted:
30-Apr-2001
Accepted:
30-Apr-2001
Key Words:
Gypsy-like endogenous retrovirus; ATHILA superfamily; long terminal repeat; reverse transcriptase; integrase; ATHILA8BLTR; ATHILA6B_I.
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryotae; mitochondrial eukaryotes; Viridiplantae; Charophyta/Embryophyta group; Embryophyta; Magnoliophyta; Magnoliopsida; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ATHILA8B, an ancient family of Athila-like retroviruses.
Journal:
Repbase Reports 1:(4) p.14 (2001)
Abstract:
ATHILA8B_I is an internal portion of the ATHILA8B endogenous retrovirus. There are several copies of ATHILA8B_I in the genome; they are ~90% identical to the consensus sequence. The consensus sequence was derived from 4 proviral copies. The internal portion is flanked by 90-92% identical LTRs (ATHILA8BLTR). Second half of ATHILA8B_I (positions 2707-5020) is 85% identical to the second half of the ATHILA8A_I internal portion (see comments for ATHILA8A_I). The first half of ATHILA8B_I (positions 483-2696) encodes a 737-aa protein, ATHILA8B1p, which is similar to the ATHILA ORF1-like proteins. ATHILA8Bp1 ATDLCSTDKTGNRTIADYDAPNRYPQERAAIRVPSPRQNFEIKPHIIGLVKQNQFHGLNTEHPMDHIDLF EEICSTTQSRGIPKDYLKCKFFPFSLADKATRWLKSLHPGSITSWEGCKSAFLNHFYTKSRSNSLRNKLQ GFQQRPVESFYEAWERFKDYERDCPHHGFPEGNLISTFYRGLHAKFQLSLDTASNGDFTTKNVDDAHAFI ENLATSNSNASTDFDRTIRTKDSDSKEMFELKNMMAQLLKNQNRALNACETVGNTEAFQGYNDTFDQEEE VNYVGTQGFYQNRGYNNNFNNNFRGNSNLSYRNPNVENPQDQNYPPVKPFQGRFQNANYNTNNFQPRASF NNNNTAPFETGPTEPAPSNESKLEMMIQDMTNENRKANQAMEVRMGNMYGDLNGKFESLTTHMKKLETQI VQNSESVKRQPDTLPGRTEENPKGFCNTVASTQTPANEAESSVPPVEPDQDVACKPEEDVKVKPECQPLR KLPKAEDPGRFVCSCSITSIEFPDSLCDFVNLMSGSVEEKIGLRDLSPSNLNLVFGDASQKTPDGLVCDL LLVVGDCLVPTDFHVLEMDEEIDKPLILGRPFLATVGAVIDHNRKKTIFTKVNKKVIYPTISKTVPNPVS PLPYHPVGPDINKEEKGNRVIRKRAPKLPSKPPNPPKISKVKIIIPPELGKESKEHIQEMIKRTKEVFLQ DKVSKTPFRRKLTIEAGAGYQDIKDAKGEAIPEAPPH
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    ATHILA8B, an ancient family of Athila-like retroviruses.
    Direct submission (December 19, 2001)

© 2001-2019 - Genetic Information Research Institute