Repbase Reports

2001, Volume 1, Issue 4
April 30, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 12

ATHILA8A_I

ATHILA8A_I is an internal portion of the ATHILA8A endogenous retrovirus - a consensus sequence.

Submitted:
30-Apr-2001
Accepted:
30-Apr-2001
Key Words:
Gypsy-like endogenous retrovirus; ATHILA superfamily; long terminal repeat; reverse transcriptase; integrase; ATHILA8ALTR; ATHILA6B_I; ATHILA8A_I
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryotae; mitochondrial eukaryotes; Viridiplantae; Charophyta/Embryophyta group; Embryophyta; Magnoliophyta; Magnoliopsida; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ATHILA8A, an ancient family of Athila-like retroviruses.
Journal:
Repbase Reports 1:(4) p.12 (2001)
Abstract:
ATHILA8A_I is an internal portion of the nonautonomous ATHILA8A endogenous retrovirus. There are ~10 copies of ATHILA8A_I in the genome; they are ~91% identical to the consensus sequence. The consensus sequence was derived from 9 proviral copies. The internal portion is flanked by ~90% identical LTRs (ATHILA8ALTR). Given the divergency of the flanking LTRs, ATHILA8A is older than ATHILA1-7 retrotransposons. Second half of ATHILA8A_I (positions 2600-5635) is ~60% identical to the internal portions of ATHILA4, ATHILA4A and ATHILA4C, including part of the Athila-like ORF1. The first half of ATHILA8A_I encodes a protein, ATHILA8A1p, which is not similar to any retroviral proteins or proteins encoded by other ATHILA-like elements. ATHILA8p1 MNSRNYPNSYYPNVNHGSNRGSHFSTGHYTPDASQMHGESWQSWSSNGGAYRTDHYSNDQSATFVQNRPQ ANRSVSPFHHCVPSPRDQRVGGPHSSHPYGVARHEDFGYDQGYLQEVMSVDVHPNNYAYQTNEPYQTAEL EDKLIGLLQDFVDDHQEDVKRIDSKMTEMKAKFEEKFDDLTNRLENMEGALVEINNTLLNHQDDIQDQNT RIVNVGFAVDTVESHLDWKIEELEKKLTNSNEFSEWRSNQSCQEEDEFPKAQARYEEETKKEIGFLVEKG KDLISYSEKGNLDPIKSLGISIPFVSPQDQIEQEEDLEEEEAVSFEEDSMAEHNSREESLETEKEEVCLE SQENRFEELSEESDELTNFSSEEGEDEELKDVHSCMAIRLPSGGIPANPSFGQLGSLEEANPRGSLGAIQ ANRPFHVGEDLDAARRAQPSRFRTPYPRRAEESYPAQHYRPPVLPMLSTRDRSHMPWKHKTHEERLEILV SQFLDQQALDTRKLNARIDDIEVTLLSKVDALFVKFKKSEGSRVKEAEANEERFKKIEEEQERHLKSAQD NAINTRALLRQISNSDKDYDAKIEALSDKDANLVSRLGKLEDHLYEEQRRVDDLSYQQNRFHETLSERTI LAAGNDELDPRDKREWSPCSGKDFSSISQDDLRRIQSRMEGVDESIWRLQTRINQLEDNDAKEDVALEDV IRRQGEVEENQVKNVDDQSKIRASLRRVTMESSRKYVELLDRILDLDKKVDNLSTRIEGHEPMESEEEDS SPHVLCDAVTTYQEPHDLEEGEIDERDEDPPGRTSVYNRLTLLEDRWH ATHILA8A is most closely related to ATHILA8B which encoded a complete ORF1-like protein, instead of ATHILA8A1p in ATHILA8A.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    ATHILA8A, an ancient family of Athila-like retroviruses.
    Direct submission (December 18, 2001)

© 2001-2019 - Genetic Information Research Institute