Repbase Reports

2001, Volume 1, Issue 4
April 30, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

ATHILA7A_I

ATHILA7A_I is an internal portion of ATHILA7A endogenous retrovirus.

Submitted:
30-Apr-2001
Accepted:
30-Apr-2001
Key Words:
Gypsy-like endogenous retrovirus; Athila superfamily; internal portion; ORF1; pol; reverse transcriptase; ATHILA7LTR; ATHILA7A_I
Source:
thale cress
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryotae; mitochondrial eukaryotes; Viridiplantae; Charophyta/Embryophyta group; Embryophyta; Magnoliophyta; Magnoliopsida; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V. and Jurka,J.
Title:
The ATHILA7A subfamily.
Journal:
Repbase Reports 1:(4) p.8 (2001)
Abstract:
ATHILA7A_I is an internal portion of ATHILA7A endogenous retrovirus. It belongs to the gypsy superfamily and is related to the ATHILA-like endogenous retroviruses. ATHILA7A is a subfamily of the ATHILA7 family. ATHILA7A_I and ATHILA7_I share ~95% identical 1.6 kb 5'- and ~2 kb 3'-terminal portions. There are two well preserved copies of ATHILA7A_I present in the A. thaliana genome; they are 96% identical to each other and are flanked by the 2% divergent ATHILA7LTR long terminal repeats. ATHILA7A_I encodes well preserved remnants of a protein similar to the ATHILA ORF1 protein (it is present also in other ATHILA-like retroviruses that populate the O. sativa, H. vulgare and V. faba genomes). The protein, ATHILA7Ap, is 930-aa. One false stop codon present in the copy deposited in Repbase Update is corrected based on the second ATHILA7A copy and other ATHILA ORF1-like proteins deposited in GenBank. ATHILA7Ap: MNEPEVGGHNGNGQANGGGHMPQHQPRAHQPIGAFDEPNIRGNRNGIQAPPVENNNFEIKSSLINMVQSS KFHCLSMEDPLDHLDQFDMLCSTVKINGISEDAFKLRLFPFSLGDRARIWEKNLPQGSITSWDQCKRAFL LKFFSTTRTARLRNEISSFTQRSNKSFCEAWERFKGYKMQCPHHGFSKESILSTLYRGVLPKFRMLLDTA SNANFLGQDIDDGLSLVENLAQSDGNYGEDYDRTPRESNEMSNLHRKEIKALNEKIDKMILANQKPIHFV SESDVYQGYQEHMEGCVERQEEVNYAIGQGYNKFNLNYRNHPNLSYRSNNVENPQDQSYPPLKPPGFTQQ PNYQPQPQRNFQPKPQAYHHNQHQGSSSNPPPQADTNALLRQILEGQGRGAIDLATQMKGMHTKVDDIYG ELNAKIERLNVHVYSPSSSTSKHPMGTLKGKSETNHKEFCNAIFINDFDMVENMSYTQSREDGRIDENEK AIEEISKLLYGSNVENLMVASDEKAKKSTNGNDMITKSVEKKEASRVEPLPYEPLLPFPGRVLTKAKKKV FSSFKANMSRVGAPLPCVENLSQIPLHFKFIQAILENREKVEEIMRAFDSPITPQTEPKSIIKLEDPGKF TIPCSLGDLQLDDALCDSGASVNVMSLEMVKSLGVKDMNHHTSSIMFGDASSTTPLGLIEDYPLKVGDCI VPTDFMIVEMKDTHKVPLILGTPFLNTVGANIDFPNKRVTLLHVNGNVSYPIKPFSTKFCGTITNEEVKT KKEPKSLKDQLEIKVVNAKNREDFTVDEKILDGECLHFLFDAQEESTKKKELGKAKMVLEKNKRMMKRTH PPTLDNSPNPTSSMTLTLLRYNDGILEYRVKCKGRSNPFSSVKAILTPEFKEKGSKSVEELMKEVLTLAF KGSTRSFTTPPITSLPKVHN
Derived:
Positions 72809 68056 Accession No AC005965 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V. and Jurka,J.
    The ATHILA7A subfamily.
    Direct submission (December 06, 2001)

© 2001-2019 - Genetic Information Research Institute