Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 33

ATLINE1_4

ATLINE1_4, non-LTR retrotransposon - a fossil.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
non-LTR retrotransposon; L1 superfamily; poly(A) tail; ORF1; ORF2; reverse transcriptase; ATLINE1_4
Source:
thale cress
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Plantae; Embryobionta; Magnoliophyta; Magnoliopsida; Dilleniidae; Capparales; Brassicaceae
[1] Authors:
Kapitonov,V. and Jurka,J.
Title:
ATLINE1_4, a non-LTR retrotransposon.
Journal:
Repbase Reports 1:(3) p. 33 (2001)
Abstract:
ATLINE1_4 is a non-LTR retrotransposon. Its individual copies are ~88% identical to each other. There are only 3 copies of ATLINE1_4 present in the genome. ATLINE1_4 belongs to the L1 superfamily of non-LTR retrotransposons, its copies are flanked by ~15-bp target site duplications. Two proteins, ATLINE1_4p1 and ATLINE1_4p2, are encoded by ORF1 (position 389-2380) and ORF2 (position 2551-6609), respectively. ATLINE1_4p2 contains the reverse transcriptase and endonuclease domains. ATLINE1_4p1 (664 aa): MSKRIRPSWYRESPPKQPPFAFEPEEEDDVVILPQVDNSALLARLHLSLVGRMFHQGGRSTKALLSFLPK ENIWDVEGRVRGVSLGDARFQFFFESEVDLQKVLNKRPCHFNKWSFALERWEPHVGTSFPNIMTFWVRTE GIPAEFWDEEVLRNFGNSLGLVRRVDPSKGRILISVTADVPLRFNKNAQLPSGTVVKVKLSYEKLFRWCS YCRRICHELEQCPLLDAEQKAVLSAEESQRNLRLSLRDGDSSQARLPLQSFPESNRSRSERNHLPLLNGP PSSRPYHSRGVIRREENNLASRSGRNRSHRQPYPASLNQYPAEHASKLNRPHGAVSHKRPASPVVTRNAG VDDGRKRRFGDSFSKEKSSAPPNKQSSPLLSDSQLTLSDTVLAPSRAKQITSSPTYVRERPFRLNLSKKA SALEKGKGKVVEHPTPLLGESSVVGSSAKKSLNFEPSEPAPKNLDTPISVTSKSLEPQLEKRKSWYDMTV EEDEATARSLESGPDTILAAKFSQVVSFASPSVVSPSLSVLPSPAAPEDEWNESLNPLSEALNLDWTEED EAAYHLADDLDVDADDLLSEELQESLQDQSGLVIPGSHVAPISELQPEKLKSLIVSSLQSEEVGPSIAIP RRKDSKKKVVPHSRKAQLNSGLCLNLASKKIHHI ATLINE1_4p1 (1354 aa, two false frame-shifts are corrected based on alignments with related proteins): MRLISWNCQGVGPKTTSRRLEEMCRMYSPGFLFLSETKNDLVYLQNVQVSLGFDCLKTVEPIGNSGGLAL FYSRDYPVKFIYVCDRLIDIETIIDGNRVFITFVYGDPVVQYRELVWKRLTRIGIVRSEPWFMIGDFNEI IGNHEKRGGKKRSESSFLPFCCMIENCGMIDFPSTGSLFSWVGKRSCGVAGRKRRDLIKCRLDRAMGNEE WHSIYSHTNVEYLQHRGSDHKPLLASIQNKPYRPYKHFIFDKRWINKPGFKESVQEGWAFPSRGEGVPFF QKIKNCRQTISIWKKSNKTNTEKLILELHSQLDLAYEDENFSTEDLLALKWKLCQAYRDEEIFWKLKSRE IWLQLGDMNTKFFHASVHKQRRARNKILGLLNQDGLWVDNEVGVEHLAENYFETLFTTSDPQVFDSALQE VPVLITEEMNKSLTKVISPEEVKRALFSLNPDKAPGPDGMTAFFYQHYWDLTGPDLIKLVQNFHSTGFFD ERLNETNICLIPKTERPRKMAEFRPISLCNVSYKVISKVLSSRLKRLLPELISETQSAFVAERLITDNIL IAQENFHALRTNPACKKKYMAIKTDMSKAYDRVEWSFLRALMLKMGFAQKWVDWIIFCISSVSYKILLNG SPKGFIKPSRGIRQGDPISPFLFILCTEALVAKLKDAEWHGRIQGLQISRASPSTSHLLFADDSLFFCKA DPLQGKEIIDILRLYGEASGQQLNPDKSSVMFGHEVDNSIRNTIKVSLGIHKDGGMGSYLGLPKQIHGSK TQVFSFVRDRLQKRINGWTSKFLSKGGKEILIKSVAQALPTYVMSCFLLPKAIRSKLSSVVANFWWKTRE ESNGIHWIAWDKLCTPFSDGGLGFRTLEEFNLVLLAKQLWRLIRFPNSLLSRVLRGRYFRYSDPIQIGKA NRPSFGWRSIMAAKPLLLSGLRRTIGSGMLTRVWEDPWIPSFPPRPAKSILNIRDTHLYVNDLIDPVTKQ WKLGRLQELVDPSDIPLILGIRPSRTYKSDDFSWSFTKSGNYTVKSGYWAARDLSRPTCDLPFQGPSVSA LQAQVWKIKTTRKFKHFEWQCLSGCLATNQRLFSRHIGTEKVCPRCGAEEESINHLLFLCPPSRQIWALS PIPSSEYIFPRNSLFYNFDFLLSRGKEFDIAEDIMEIFPWILWYIWKSRNRFIFENVIESPQVILDFAIQ EANVWKQANSKEVATEYPPPQVVPANLPPTRNVCQFDASWHLKDTLSGHGWVLVDQDIVLLLGLKSARKS LSPLHAEVDSLLWAMECMISLGVSDCSFASDSADFISLLENPSEWPTFVAELATFSSLVCFFPSFSIKFF SRIYNVRADCLSKKARARNSLFSM
Derived:
Positions 35574 28875 Accession No AC006248 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute