Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 26

ATCOPIA91_I

Internal region of the ATCOPIA91 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA91 family; ATCOPIA91LTR; ATCOPIA91_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA91 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 26 (2001)
Abstract:
ATCOPIA91_I is an internal region of the ATCOPIA91 copia-like endogenous retrovirus flanked by the 93% identical ATCOPIA91LTR long terminal repeats and a 5-bp target-site duplication (TTTTT). ATCOPIA91 forms a separate family of copia-like retroviruses present in the A. thaliana genome since members of other families are less than 75% identical to ATCOPIA91_I. ATCOPIA91_I (positions 357-4973) encodes remnants of the ~1540-aa ATCOPIA91p copia-like polyprotein. The ORF which encodes ATCOPIA91p is damaged by two indels that produce false frame shifts at positions 735 and 2162 (marked by Xs in the ATCOPIA91p sequence). ATCOPIA91p: MTTSSNTNVDSSRQSIDQYENPFFLHSSDHAGLVLVFDRLTTGADFHSWRRSVRMTLNVRNKLGFIDGNI TKPSPDHHDFGSWSRCNDMVATWLMNSVCKKIGQSLLFISTAEGIWKNLLARFKQDXXAPRVYEIEQRLS IIQQGAMDVSSYYTELVTLWEEYRNYVELPVCTCGRSECNAAVLWERLQQRSRVTKFLMGLNESFESTRR QILMLKPIPTIEDAFNMVTQDERQRSIKTPSSKTVVFQASGPNQSSGQCYQDVSSYQGQMDNTAFAVQNE YRPRPPRPVCTQCGQSGHVVQKCFKIIGYPPGYIPRFKSTISNYQSQRSPAPSTFQPRGYSANAASKPHS VANIMTNPPSLYIPPPATEVNNLDINKLSGDQIQTLIQQLSGRIQTSEPLAPSPSTSAPSTVTEHGIMAV QSSAGTIPFPSSSLRFENDQLTFQHQCLSSLYTNLPHGSWIIDSGATTHVCSDLAMFNETNTVFGVTVSL PNDTRVQITHTGTIPLSHSLILQDVLHVPSFKFNLISVSSLLKTNHCSSHYYVDSCIIQEFIQGLTIGRG ILLHNLYILRLDAPSTHDQFAGSLVVDGILWHQRLGHPFADKLKCIXMHRISGTLSSSKSSFMHPFHCSI CHLAKQKRLSYESHNHLSSLSFDLVHLDVWGPFSIESLEGYKYFLTIVDDCTRVTWVYMMRNKSEVTQHF SDFIKHVLTQYKAVIKMIRTDNAPELAFKSIVKEHGMVHQFSCAYTPQQNSVVERKHQHLLNVARSLLFQ SNVPIAYWSDCLLTVVFLINRIPSVLLKNVSPYELLTKRKPAYDFLRSFGCLCYVSTLQKDRNKFSPRSE KCIFLGYSSSYKGYKVLHIDLNCVSVSRNVVFHENIFPFHDNPISPVSDVFSHAILPLPIHVNDEIHTSS SPNAHNEHSHASSASSSSTTSSQPSTSSSSIIPVLPEAVTTETACVSLSVARPKRQGKAPSYLSDYHCSF TQISEPSPQNSFPHLKVYSTPYLISSVLSYSSLKSPFQSFVLSYSAETEPKTFKQAIISVQWTKAMDEEL GAMELNKTWSVVSLPPGKNVIGCKWVYTIKYNPDGTIERYKARLVAKEFTQQEGVDYFDTFSHVAKLASV KLVLGCAAKKGWSLTQIDVSNAFLHSELDEEIYMSLPQGYTPSSGFLPSHHVCRLHKSIYGLKQTSRQWY KCLSKTLLDAAFIQSQSDNTLFVQLQGTSFIAILVYVDDILIASNDSNQVTLIKAYMADHFKIKDLGPAR FFLGLEIARNSEGIAICQRKYCLDLLTDAGLLGCKPSTVPMDPKVNLTADMGTLLDNAKPYRKLVGRLLY LCVTRPDITFAVHRLSRFLSCDTDVHMQAAQRVLKYLKGNPGQGLFYSTNTSLCLNGFADADWGTCLDSR RSVSGVCIFLGTFLISWKYKKQDVCSSSSTEAEYRSMAVATKDLLWFSYMLKDLHIKVETKAKLFCDNKS AMHIANNPVFHERTKHVEIDCHTTRDQMKFGFLQVHHIGTENQLADILTKPLHPGPFKSLLNRLGVSNLF LPKE
Derived:
Positions 28125 23138 Accession No AB026643 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute