Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 24

ATCOPIA90_I

Internal region of the ATCOPIA90 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA90 family; ATCOPIA90LTR; ATCOPIA90_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA90 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 24 (2001)
Abstract:
ATCOPIA90_I is an internal region of the ATCOPIA90 copia-like endogenous retrovirus flanked by the 99% identical ATCOPIA90LTR long terminal repeats and a 5-bp target-site duplication (GAAGC). ATCOPIA90 forms a separate family of copia-like retroviruses present in the A. thaliana genome since members of other families are less than 75% identical to ATCOPIA90_I. ATCOPIA90_I (positions 442-4878) encodes remnants of the 1479-aa ATCOPIA90p copia-like polyprotein. The ORF which encodes ATCOPIA90p is damaged by two false stop codons at positions 2503-2505 and 3457-3459 (marked by Xs in the ATCOPIA90p sequence). ATCOPIA90p: MALNVRNKLGFIDGTILKPNETHKDFGSWSRCNDMVATWLMNSVSKKIGQSLLFISTAEGIWKNLMSRFK QDDAPRVYEIEQRLSVIQQGSMDVSAYYTELVTLWEEYRNHVELPVCTCGKCECNAAALWEKLQQRSRVT KFLMGLNESYEATRRHILMLKQIPTIEDAFNMVTQDERQKNIKPVSKIDNVVFNTSDNNQLSYYDGSVQN QNQNVYQGPLDNNVYAAMQNQYIPRAPRPVCTYCGQTGHVIQKCFKKHGYPPGYIPGFKSNGGYQNQPTR PFTPFFNQNLDPRAQFSNSRPTTQHAANMMNGNQQAISAPNVDVSQMNKEQMQSLLQQLNSQVQLSENQV PIPLVASVTQNGVMDSQSFSGSVSFPSTSLRFENNKLTFQHQCLSSLSNQIPQGSWIIDTGATSHVCSDL TLFNDIVTVTGVTVSLPNATRVEIAHTGTIHLSSSLILHDVLHVPSFKFNLIFVSSLLKHSNASAHFFPD FCYIHESIQNLMIGKGVLLHNLYILELDSPHPATHSSLSAPHFSGSLMVDGHLWHQRLGHPSSDKLKLLS GTLSMPKNSSLVESHCPVCPLAKQKRLSFESHNHMSSSPFDLIHLDVWGPFKRESVEGYKYFLTIVNDHT RVTWIYMLRNKSDVSKCFPVFLKYVSTQYNAILKRIRTDNAPELAFTDILEQSGITHXFSCPYTPQQNSV VERKHQHLLNVARSLMFQSNLPLAYWSDCILTSVFLINRIPSKVLNNLTPYEMLTKKAPDYSFLKSFGCL CYVSTLQKDRHKFSPRADKCVFLGYSSGYKGYKVLHLDSNIVSVSRNVIFHEKDFPFKTATHSIPASDIF DKCVLPASTPFDIDSPSHIHHDASDIHTPALHTTPHSSVTDHSQEAVTSDTTTVSLPTVRPKRTSKAPGY LSDYHCALIQTSSPPEKVTTTPYHISSFLSYDQFSPDYQSFICNISIETEPKIFKQAIISEKWTAAMGVE LGSMELNKTWSVVSLPQGKNVVGCKXVFTIKYNADGSIERYKARLVAKGFIQQEGVDYFDTFSPVAKLAS VKLLLDLTAKKGWSTSQMDISSAFLHSDLEEEIYMSLPEGYTPPDGVPLPPNAVCRLHKSIYGLKQASRQ WYKCLSAVLLDDGFIQSYADNMLFVKVTGTSIVALLVYVDDILIVSNDDEAVRSVKAVLGKHFKTKDLGE AKFFLGLEIARNADGISVSQRKYCLDMLADSGLLGCKPKSVPVDPKVPLTKETGTLLENARPYREIIGRL LYLCITRPDITYAVNRLSQFLSCPTDVHLQAAYQILKYLKNNPGQGLFYSSQPDICLNGFADADWGTCLD TRRSTSGMCVFLGHSLITWKSKKQDIVSSSSTEAEYRSMAVTTKELLWLSQMLKDLHIQVDSSAKLFCDN KSATYIAINPVFHERTKHVEIDCHITRDQVKNGFLKVLHVATENQLADIMTKPLHPGPFYSLLSRLSVSS LFNPSDDSA
Derived:
Positions 30244 25358 Accession No AC069326 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute