Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 22

ATCOPIA89_I

Internal region of the ATCOPIA89 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA89 family; ATCOPIA89LTR; ATCOPIA89_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA89 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 22 (2001)
Abstract:
ATCOPIA89_I is an internal region of the ATCOPIA89 copia-like endogenous retrovirus flanked by the 99% identical ATCOPIA89LTR long terminal repeats. and a 5-bp target-site duplication (AACAT). ATCOPIA89 forms a separate family of copia-like retroviruses present in the A. thaliana genome since members of other families are less than 75% identical to ATCOPIA89_I and ATCOPIA89LTR. ATCOPIA89_I (positions 91-4566) encodes remnants of the 1492-aa ATCOPIA89p copia-like polyprotein. The ORF which encodes ATCOPIA89p is damaged by one false stop codon at position 1690-1692 (marked by X in the ATCOPIA89p sequence). ATCOPIA89p: MGVPVRKSTRRLGRSVGAGSSGTKLKAPMSSNSPDPAPVVPIRSISEIDAVDSPHSPFFLHSADHPGLTL VADRLDGTNYTQWSSAMKISLDAKNKIAFIDGSLPRPAEGTPLSRIWSRCNSMVKSWLLNAVSKQIYGSI LNLDDATMIWNDLHDRFHMTNLPRTFHPIQQIQDLRQGSMDLSSYYTALKTLWDQLDGSEPTESCLCCHS FNCVSKRHYRGKVDRGRIIKFLAGLNETYSIIRGQIIMKKPLPDIAEVYHILDQDDSQRKFGNSIVPAAF QVGIAGSHPGVVNADASSPSAGSLIAAYQSFKKDKPTCSYCGFTGHVVDRCYKKHGYPPGWKPRKQQVNA SPTPQSSSPAITAQVSATVGSGDKQDGGLDSLIGNLSKEQLQHFIAYFSSHLTTQFPASVPLNEASTSGI SFSPSTYSFIGILTVTQSVTNKRSWIIDSGATHHVSHDKSLFSDLDASVSQHVNLPNGSVVMVAGVGTVI INTSISLKNVLYIPDFRMNLLSISSLTTDLGSRVIFDPASCLIXDPTKGLTIGRGRRIANLYLLDVEEPA DSRQLSSYSLNDVIDSAVWHKRLGHTSFSRIDMLTDVLGISKQRNKGVIHCDICQRAKQKKLSYPNRNNL CSASFDLLHIDVWGPFSEPTVEGFRYFLTIVDDHTRVTWVYLLRLKSDVLTVFPEFLQMVETQFDKRVRC VRSDNAPELKFTELYRRLGIIPYHSCPETPEQNSVVERKHQHILNVARALLFQSNLPLSLWGDCILTAVF LINRTPSPLLENKTPFEKLTNTTPEYTDLRTFGCLCYASTSPKQRTKFEDRAKACVFLGYPAGYKGYKLM DIESNVVFISRNVKFFEDIFLFQNSQASDEVDVTGFFPQISTRVADPGESSGTRTEGEYSSTMRQGESNS ESVIPNTEDTSRRRVSRPPGYLQDYQCYSVKESVKESTEHPISQVFSTDNLSSSYCAYINALTKYPTPTS YTQASKVKEFCDAIKDEIGALERTNTWIVCAIPPGKTVVGCKWIYTIKLNADGSLERYKARLVAKGYTQK EGLDYVETFSPVARMATVKFLLSVAAPRKWFLDQLDISNAFLNGDLHEEIFMALLPGYVDKDGKPFPPNS VCKLQKSLYGLKQASRQWFLKLSHCLMSMGFRNGTGDDTLFLRRTDDTYMAILVYVDDIIIASSSSTATA SFTAALKESFKLRDLGPLKYFLGLEVARTSAGISICQRKYVLDLLDETGLLGCKPSSIPMDPSQKLNLET GDLLTDVEMYRRLVGKLMYLTFTRPDITFAVHKLCQFTSAPRQPHLTAVYKVLHYLKGTIGQGMFYSANS DLKLKSFSDADWGTCTDSRISVTGFCMFLGPSLVSWKSNKQETVSMSSAESEYKAMSTAVKEMLWLRKLM NDLWIDASEASVLYCDNTAAIHIANNSVFHERTKYLDLACHLVRERVLMGQIKTLHVQTEHQLADALTKP LYPTLFLRLIRKMGVINIYTPS
Derived:
Positions 74828 70253 Accession No AC068809 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute