Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 18

ATCOPIA87_I

Internal region of the ATCOPIA87 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA87 family; ATCOPIA87LTR; ATCOPIA87_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA87 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 18 (2001)
Abstract:
ATCOPIA87_I is an internal region of the ATCOPIA87 copia-like endogenous retrovirus flanked by the 99% identical ATCOPIA87LTR long terminal repeats, and a 5-bp target-site duplication (TAGAC). ATCOPIA87 forms a young family of copia-like endogenous retroviruses present today in the A. thaliana genome. ATCOPIA87_I encodes well preserved remnants of the 1338-aa ATCOPIA87p copia-like polyprotein. ATCOPIA87p: MVSELQVKEETSQEPRFERFDGRGDYTLWKRKLLAQLEVMGISDALKEKEEKKEAVETERVKVVSSSSER RREEHKKDHSREEKENKARSVIILSVADNILRRIRTEETAAGMISVLDKLYLSDPLSSRISLKRKLFEFK MSENKAVEENIEDFFRIVEDLEKLDVYVSDEDKAFMLLLSLPRKLEQLKYSLDYCEEPLTLGRVMTAIYK KELEVAQIERQTEEEEKRLSLRERERSDYREEQAKGKEKVRSEAREKKGPCWRCGQKGHVKTECFQEKKN KSRKKSVRYEESSAQSIVSGGSVFMVSEAAARASKGSSEEWICDTGCTSHMSSRKEWFEDLVFSESGNVS MANDTTLQVKGIGSVRILNDDGTTVLLTNVMYIPGMSKNLISLGTLENKGCWFKSKNGILKVIKGCITLM KAEKVGTLYMLKGKAVTARRRAVQGPKEETKMEHIKPAHMSQTSLEIPVKKGCIRKQKIGEVKVCEDRAQ KEVKRIKFDSEKIVTEMKPKIVHSKIWSFASTPRKIKEGLRIKGITAKETGKSVCDTILLKSCTGGVDIA VNLKKSLFSSSFEVSRDKETSSASNCRKLVISQDEKFQRDIICECCQEHECERRKCVSEKGIFSLHDKNE LVYNESVIQGGASSSENSQQHSSLNSHQVMATFMRSRKEEMAKDGTYHHSTSHQVSMKRSGVTVYAPSSQ RKPSPRERNIISVGCYDGEIFFKILLPEDKEDCFIRKNAEFLEGYLIKVLNLKFQDLEDQRRKSVRVSLK SLQDYETSSFQVQGGAYSAKGSFISEGQESLNTSLQGRDAASETSEEETDLQGYLLTRINVKREVQPSKK DEETKLVGSVQFIIEDAGKTEPTSFEEEKRDPSWSKVEEIQFLHNRDTWDLADKLMNQEASICKGIYKKK PEFSGIGKPSFKVNLRVKGHSKEKVVLKLMEMKQKTDFLHENSEKNIRMLQPAVYEEKSRKEKAFLLENF LYGLKNLPRSQNQRNDTLLIQDGYMRSKYVLWVYFKVSKMEIHQNRGFESPRLSQEAYVIKVIRLFKEDQ CEFVFTSSETLFEFQALEEEKQGDQADYMKLISCLSDVDSVVVAIIGTRVNIAWFRGVVFRSKKEHWKSM LRRMRGIKGTTESVQVHRKQEDFELTRVNDSKVAVGADQKRVLTCRSFTTAGSSISCKYMFQEVDFVSTK KGERNRWTGAYKRVVWVRDFKDLIESSLVFKKQEESMLRGCYSSKFAAGSVLKVNFQQCVFSFAGNTLRR ESGLLKVGVSSTTEAEKRVQEMDIQETVLSRELLDMDTGGLKKTTKLGMLSSAAGVVTKGLTRSMFQDGG PMLRFTKN
Derived:
Positions 25401 29487 Accession No AB028606 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute