Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 10

ATCOPIA83_I

Internal region of the ATCOPIA83 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA83 family; ATCOPIA83LTR; ATCOPIA83_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA83 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 10 (2001)
Abstract:
ATCOPIA83_I is an internal region of the ATCOPIA83 copia-like endogenous retrovirus flanked by the 99% identical ATCOPIA83LTR long terminal repeats, and a 5-bp target-site duplication (AGATA). ATCOPIA83 forms a separate family of copia-like retroviruses present in the A. thaliana genome. There are two nearly identical copies of ATCOPIA83 found on chromosome 5. However one of them is a result of a ~14-kb duplication. ATCOPIA83 is most close to ATCOPIA26. There is a 74% identity between LTRs and internal portions of these two retroelements. ATCOPIA83_I encodes well preserved remnants of the ~1500-aa ATCOPIA83p copia-like polyprotein. ATCOPIA83p (nucleotides at positions 982 and 983 form a false frame shift; we have deleted them to produce this polyprotein): MSTELALTTSSSTTTQPRRTISPYDLTSGDNPGTLISKPLLRGPNYDEWATNLRLALKARKKFGFADGTI PQPDETNPDFDDWIANNALVVSWMKLTIHESLATSMSHLDDSHDMWTHIQKRFGVKNGQRIQRLKTELAT CRQKGTPIETYYGKLSQLWRSLADYQQAKTMEEVRKEREEDKLHQFLMGLDESMYGAVKSALLSRVPLPS LEEAYNTLTQDEESKSLSRLHDERNDGVSFAVQTTPRTRSLTKNKDSAIVCSHCGRLGHLAENCFKLVGY PPWQEKMRRNATSSSRNQSASMGRGSSVVPATSFKGKQSFGRGASANHVANIGESTTAATSSMSGSQLTE ADRVGISGLNDEQWKQLRQMLKERNFNSTNTKSSKFFLESWIIDSGATNHMTGTLEFLRDVCDMPPIMIK LPDGRLTTSTKHGRVYLGSSLDLQEVFFVDGLHCHLISVSQLTRAKSCVFQITDKVCIIQDRITLTLIGA GKQQNGLYFFRGTETVASMTRMDSSSQLWHCRLGHPSSKVLKLLSFSDSTGHAFDSKTCEICIKAKQTRD PFPLSNNKTSSPFEMVHCDLWGPYRTTSICGSNYFLTLVDNYTRAVWLYLLPSKQTAPMHLKNFISLVER QFSTKIKTIRSDNGTEFVCLSSFFVDHGIIHETSCVGTPQQNGRVERKHRHILNVARALRFQARLPIEFW SYCALTAAYLINRTPTPLLQGKTPFELLYNRPPPVNHIRVFGCICYVHNQKHGGDKFESRSNKSIFLGYP FAKKGWRVYNFETGVISVSRDVVFRETEFPFPASVFDSTPDSQLSPSNADQSFFLPSELQAPTPVSITTT LELTQSSSSTNLNDDNFHIPSDESSSVNEMSDNEDLNSPTTNESSPFLSPASPSLPLSPASLSLPLSPAA PSPSLPKIAEPEPEPELLGKGKRKKTQPVRLADYATTLLHQPHPSVTPYPLDNYVSSSQFSAAYQAYVFA ISLGIEPKSYKEAILDENWRCAVSDEIVSLENLGTWTVEDLPPGKKALGCKWVFRLKYKSDGTLERHKAR LVVLGNKQTEGIDYSETFAPVAKMVTVRAFLQQVASLDWEVHQMDVHNAFLHGDLDEEVYIKFPPGFGSD DNRKVCRLRKALYGLKQAPRCWFAKLTTALNDYGFIQDISDYSLFTMERNGIRLHILVYVDDLIITGSSL DVITKFKGYLSSCFYMKDLGILRYFLGIEVARSPAGIYLCQRKYAIDIITETGLLGVWPASHPLEQNHKL ALAFGDTISDPSRYRRLVGRLIYLGTTRPELSYAIHMLSQFMSDPKADHMEAALRVVRYLKSSPGQGILL RSNTPLVLIGWCDSGFDSCPITQRSLTGWFIQLGGSPISWKTKKHDVVSRSSAEAEYRAMADTVSELLWL RALLPALGISCNEPIMLYSDSLSAISLAANPVYHARTKHVGRDVHFVRDEIIRGTIATKHVSTTSQLADI MTKALGRREFDAFLLKLGICNLHTPACGGGGGG
Derived:
Positions 14350 9708 Accession No AB010694 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute