Repbase Reports

2001, Volume 1, Issue 3
March 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

ATCOPIA82_I

Internal region of the ATCOPIA82 copia-like LTR-retrotransposon.

Submitted:
31-Mar-2001
Accepted:
31-Mar-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; the ATCOPIA82 family; ATCOPIA82LTR; ATCOPIA82_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal portion of the ATCOPIA82 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(3) p. 8 (2001)
Abstract:
ATCOPIA82_I is an internal region of the ATCOPIA82 copia-like endogenous retrovirus flanked by the 98% identical ATCOPIA82LTR long terminal repeats, and a 5-bp target-site duplication (TTGGT). ATCOPIA82 forms a separate family of copia-like retroviruses present in the A. thaliana genome. ATCOPIA82_I encodes (positions 14-4279) well preserved remnants of the ~1422-aa ATCOPIA82p copia-like polyprotein. A false stop codons at position 1756 corresponds to H (based on polyproteins most close to ATCOPIA82p). ATCOPIA82p: MDSQIQLYSHPVIHISNYVTVQLTERNYLLWKTQFESFLSGQNLLGFVNGAIKPPPAVNTLTQINGLTTE VQNPDYQAWQRSDQVVRAWLLGSLSEDILREVVHTITAQEVWTALAQHFNKVSSSRLFKLQRKLQTIEKL DKSMEDYVREIKRICEQLASIGNPVSQKMKIFAALHDLGRDYEPIKTSIEGSMDLHPPPTFESVIPRLTG FADRMAGYNAGNEVSPHLAFNITTTNGSHYYSSQGRGNGKPGNNNKGRLNFTTKGRGFHQQISSGSSGGD RIICQICGKPGHPALKCWHRFNNSYQHEELPSALAALRITDVTETAGHDWFTDSAATAHVTNSTNRLQQS QPYSGSDAVMVGNGEFLPITHTGSTSLQSTSGNLPLTDVLVCPDINKSLISVSKLTSDYPCCVEFDCDTV RITDKATKRLLTMGHHNKGLYMLKNHSPLEVYYSSRQQAASDAVWHRRLGHPNAQILQHLSTTKAISVNK NTKMVCEACQLGKSLKLPFSASSFVASRPLQRIHCDLWGPSPIMSVQGFRYYAVLIDNYSRFSWFYPLKL KSDFALIFPVFQAMVENQFQ*KIGTFQCDGGGEFISKDFIAHLQKHGIQQLMSCPHTPQQNGLAERKHRH IIELGLSMIFQSSMPQKYWVEAFYTANFLINLLPSSVLEKKCSPYEVLMGKPPNYTSLRVFGCACYPTLR DYATTKFDPRSLKCVFLGYNDKYKGYRCLLPTTGRVYISRHVIFDESLFPFSSMAYIHLQPANVTPLMSA WLKGCSVQEQNQTGTSTENQDHNDQNSVPSGRVLLREEESTGCTAGFDHVPIGNSSSSSTQQITTSEDSP IIQPLPSTTEQSTQNQSSQSASSNSESSQVQTAQPSQSTHPMTTRLKDGIRKPNPRYGLHTQRVSYPEPK TVTAALKDEGWTDAMHEEMDNCSEAKTWSLVPYTPNMHVLGSKWVFRTKLNADGSLDKLKARLVAKGFNQ EEGIDYLETYSLVVRTPTVRSVLHLATIMQWDIKQMDVKNAFLHGDLTETVYMMQPAGFVEKSKPDHVCL LHKSIYGLKQFPRAWFDKFSTYLIEFGFECSKPDPSLFVYIKNKSIILLLLYVDDMIITGNSSDAMSKLL DSLNTEFRMKDMGRLHYFLGIQVQFHSEGMFLSQQKYAEDLLAVAVMSDCAPMPTHLPLQLTAIPAQDEI FDNPTYFRSLAGKLQYLTLTRPDIQFAVNFVCQKMHAPTVSDFNLLKRILRYIKGTITMGISFNKNTYCR LRAYCDSDYGNCIDSRRSIGGYCTFLGTNIISWSSQKQDSVSKSSTEAEYRTLSDTASEVTWLGSVLKEL GIPLLDTPEIYCDNLSSVYLSANPAFHKRSKHFQLHYHYVRERVALGALIVKHIPGHQQIADIFTKSLPI KPFCDLRYKLGVDVPPTPSLRG
Derived:
Positions 60791 56513 Accession No AP001298 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute