Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 39

ATENSPM1A

ATENSPM1A, an autonomous DNA transposon - a consensus.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
autonomous DNA transposon; En/Spm superfamily; 3-bp TIR; transposase; ATENSPM1A
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Plantae; Embryobionta; Magnoliophyta; Magnoliopsida; Dilleniidae; Capparales; Brassicaceae
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ATENSPM1A, an autonomous DNA transposon - a consensus.
Journal:
Repbase Reports 1:(2) p. 39 (2001)
Abstract:
ATENSPM1A is an autonomous DNA transposon from the En/Spm superfamily. Its individual copies are ~98% identical to the consensus sequence. Five copies of ATENSPM1A are present in the genome. They are bordered by 3 bp-long target site duplications. ATENSPM1A has 29-bp TIRs. There is a 84% identity between the ATENSPM1A and ATENSPM1 consensus sequences. ATENSPM1A encodes two proteins: ATENSPM1A1p (CDS: 1434-947 and 231-96) and ATENSPM1A2p (CDS: 1584-1855, 2073-2199, 2277-2567, 2664-2885 and 3402-3776). Function and classification of ATENSPM1A1p is unknown. ATENSPM1A2p is a transposase. ATENSPM1A1p: MKKKLDRREAVRSEKKTLPWRQKRSSRGCCWRRRVATAAGEEESRRLLEKKSRDGCWRRR DATEKKKKLDRTVEVGMERRSYIGEEDVTLEKKQIDSRLKLEKKSCGGCWRIRDAAEKKK RGGDVIRSKKKRGGGEENRSEKKRSRRRGKQIGEEENRRKKIRVKICDVSAWDLRRIISF LRNHRTSLANLRGSLPSQVLRRNCYARA ATENSPM1A2p: MPSSENTYARYRSQQRDPLHVNSPVSAGNISGVQGSRHPPSPPTPTTQPSVNHSDSQAER LNNLTLEELLDSPGRAGLTRLDPKRPPGTLWFDDDAAVAATVRSIFERDFKEPHANWSQT SKATIDRWYETFAQVYNWDRSINKRVRVEFEAKLKSRMTDQVSRWKGNWKEKGDEAKPKW IDPDVWKGLVLFWQDPKSEKRVTTAEMLGIMIRMAKASINTVQARPHTKLCEKTGEKTPD FLELLDETHRKADGSFIDGKSEEIYKQVTSRIEEEESHMGSGDNPESTGSGGLSVHAKNK IFTEVAPRKKGRIYGVGSLQFEASSAHSGPTLPSDDPVILSAKLAAAEACIQNQAEKINS FDILFDYLAEKDPALAAILRRGSSTQTRPVSANEPPVATAPEQQANEETAAAAALANLAT GSSPSSVF
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute