Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 34

ATCOPIA76_I

Internal region of ATCOPIA76 copia-like LTR-retrotransposon.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA76LTR; ATCOPIA76_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA76 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(2) p. 34 (2001)
Abstract:
ATCOPIA76_I is an internal region of the ATCOPIA76 copia-like endogenous retrovirus flanked by the 99% identical ATCOPIA76LTR long terminal repeats, and a 5-bp target-site duplication (GGTTT). ATCOPIA76_I encodes the 1361-aa ATCOPIA76p copia-like polyprotein A corresponding CDS is interrupted by a copy of ATGP2NLTR1, which is flanked by the GACAT target site duplication. The ATGP2NLTR1 and one the GACAT repeat were removed from the ATCOPIA76_I nucleotide sequence. ATCOPIA76p: MSAARIEVEKFDGRGDYTMWKEKLMAHLDILGLSVALKEEDDLVEKVAEMQLTEEEEKEEVLRRELLEEK RRKARSAIVLSVTDRVLRKIKKEQSAAAMLGVLDKLYMSKALPNRIYQKQKLYSFKMSENLSIEGNIDEF LRIIADLENTNVLVSDEDQAILLLMSLPKPFDQLRDTLKYGLGRVTLSLDEVVAAIYSKELELGSNKKSI KGQAEGLFVKEKTETRGRTEQRGNNNNNKKSRSKSRSKKGCWICGEEGHFKSSCPNKNKTQPQTKTTNNN NKGESSNGSSNYSEANGLYVSEALSSTDIHLEDEWVMDTGCSYHMTYKREWFEDLNEDAGGSVRMGNKTV SKVRGIGTIRVKNEAGMVVRLTNVRYIPEMDRNLLSLGTFEKSGYSFKLENGTLSIIAGDSVLLTVRRCY TLYLLQWRPVTEESLSVVKRQDDTILWHRRLGHMSQKNMDLLLKKGLLDKKKVSKLETCEDCIYGKAKRI GFNLAQHDTREKLEYVHSDLWGAPSVPFSLGKCQYFISFIDDYTRKVRIYFLKTKDEAFDKFVEWANLVE NQTDKRIKTLRTDNGLEFCNRSFDEFCSQKGILWHRTCAYTPQQNGVAERMNRTLMEKVRSMLSDSGLPK KFWAEATHTTAILINKTPSSALNYEVPDKRWSGKSPIYSYLRRFGCIAFVHTDDGKLNPRAKKGILVGYP IGVKGYKIWLLEEKKCVVSRNVIFQENASYKDMMQSKDAEKDENEAPPSSYLDLDLDHEEVITSGGDDPI VEAQSPFNPSPATTQTYSEGVNSETDIIQSPLSYQLVRDRDRRTIRAPVRFDDEDYLAEALYTTEDSGEI EPADYSEAKRSMNWNKWKLAMNEEMESQIKNHTWTVVKRPQHQKVIGSRWIYKFKLGIPGVEEGRFKARL VAKGYAQRKGIDYHEIFAPVVKHVSIRILMSIVAQEDLELEQLDVKTAFLHGELKEKIYMVPPEGYEEMF KEDEVCLLNKSLYGLKQAPKQWNEKFNAYMSEIGFIRSLYDSCAYIKELSDGSRVYLLLYVDDMLVAAKN KEDISQLKEELSQRFDMKDLGAAKRILGMEIIRNREENTLWLSQNGYLNKILETYNMAESKHVVTPLGAH LKMRAATVEKQEQDEDYMKSIPYSSAVGSIMYAMIGTRPDLAYPVGIISRYMSQPAREHWLGVKWVLRYI KGSLGTKLQYKRSSDFKVVGYCDADHAACKDRRRSITGLVFTLGGSTISWKSGQQRVVALSTTEAEYMSL TEAVKEAVWMKGLLKEFGYEQKSVEIFCDSQSAIALSKNNVHHERTKHIDVRYQYIRDIIANGDGDVVKI DTEKNPADIFTKIVPVNKFQAALTLLQVKPE
Derived:
Positions 95983 89644 Accession No AC006841 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute