Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 24

ATCOPIA69_I

Internal region of ATCOPIA69 copia-like LTR-retrotransposon.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA69LTR; ATCOPIA69_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA69 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(2) p. 24 (2001)
Abstract:
ATCOPIA69_I is an internal region of the ATCOPIA69 copia-like endogenous retrovirus flanked by the 4% divergent ATCOPIA69LTRs and a 5-bp target-site duplication. ATCOPIA69p, a 1348-aa copia-like polyprotein encoded by ATCOPIA69_I is free of false stop codons and frame-shifts. ATCOPIA69p: MSSTKLKISQFDGSGDFSLWKTRMFSHLRVMGLKDALVEQEQLPPLKDEEESDPAKKKQRIDEEKARIDR DEKAMDMIFINVGDKVLRNIENSKTAAEAWATLDRLYLVKSLPNRVYLQLKVYNYRMQDSKTLEENVDEF LKMISDLSNLQIQVPDEVQAILILSALPDSYDMLKETLKYGREGIKLDEVISAAKSKELELRDSSGGSRP VGEGLYVRGKSQAGGVGNKSTEGKKVCWICGKEGHFKRQCYKWLEKNKGNSAGETALVKDDAQDLVGLVA SEVNISEDKNDQEEWIMDTGCSFHMTPRKEYLINFEKAKSGKVRMANNSYSEVKGIGSVRFVKKDGTSIV LQGVRYIPEISRNLISMGTLEAEGYEFKGNHGILRVMQDSNEFIRGRRRASLYILEAQAEMANSESLVTT TGETDQTQLWHSRMGHIGQQAMDILSKKGCFGNDKISEIKFCEDCVIGKTHKVSFGTAQHTTKEKLDYVH SDLWGSPNVPYSLGRCQYFISFTDDWSRKVWIYFLKTKDEAFQSFTEWKTMVETQSERKLKHLRTDNGLE FCNHKFDGICKKEGIVRHRTCTYTPQQNGVAERLNRTIMNKVRSMLSESGLDKKFWAEAAATSVYLINRS PSSALENKIPEELWTSAVPSLSGLKRFGCIVYVHSQEGKLDPRAKKGVFLGYPQGVKGFRVWMIDEEKCS ISRNVVFREDVMYKDILNKLTSGMSLELPFVTNKVPSFECTGLNKDGERLVQGGAIEKESDETLELSNTD QEDTGTERIQRTHQIARDKPKRQIVIPSRLKDYEMNEEILDEIAGYAYLITEDGGNPEPTDFQEVLQDPD NKKWLEAADEEIESLIKNKTWTLVDRDNSQKPIGCKWIFKRKAGIAGVEQPRFKARLVAKGYAQKEGIDF QEIFSPVVKHVSIRLLLSMVVHLNMELQQMDVKTAFLHGYLDETIYMDQPEGYIHEKYPDKVCLLKRSLY GLKQSPRQWNNRFNEFMQRIGYERSKYDSCVYYKILLSGDYIYLLLYVDDILIASKDKEQVCELKTLLNS EFEMKDLGDAKKILGMEITRDRQAGTLTISQEGYLLKVLKDFGMDQAKSVNTPMGIHFKLKPANDEEVQK QSEVMRAIPYQSVVGSLMYSMISTRPDLAHSVGLVCKFMSKPLKEHWQAVK*ILRYISGTLDRKLCYKNE GECILEGYCDSDYAADKGSRRSTSGVVFTFGGNTISWKSNLQKVVALSSTEAEYMALTDAAKEAIWLKGL VNELGFTQKTVNIHCDSQSAIALAKNAVYHERTKHIDVKYHFIRDLVNNGEVQVLKIDTEDNPADIFTKV LPVSKFQDALELLRVSQN
Derived:
Positions 133749 129480 Accession No AL161502 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute