Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 20

ATCOPIA66_I

Internal region of ATCOPIA66 copia-like LTR-retrotransposon - a consensus sequence.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA66LTR; ATCOPIA66_I
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA66 copia-like LTR-retrotransposon - a consensus sequence.
Journal:
Repbase Reports 1:(2) p. 20 (2001)
Abstract:
ATCOPIA66_I is an internal region of the ATCOPIA66 copia-like endogenous retrovirus flanked by the 1% divergent ATCOPIA66LTR long terminal repeats, and by a 5-bp target-site duplication. There are two copies of ATCOPIA66 present in the genome, they are 99% and 98% identical to the consensus sequence. ATCOPIA66's closest relative is 93% identical to the consensus sequence (ATCOPIA66A: AC007188, positions 36655-41067). ATCOPIA66_I encodes the 1372-aa copia-like polyprotein ATCOPIA66p. ATCOPIA66p: MAMTSEANLNSGLKASFQVFNENSDFSLWKTRMKAHLGLAGLKGVIDDFTLTKVVPLTKSEGKKVEEGDD DGSESSQTKEVPDLVKMEKSEQAMNVIIAHVGDVVLRKIDHCKSAAEMWETLNKLYMETSLPNRIYVQLK FYSFKMNDTMSINENVNEFLKIVAELSSLEIVVGEEVRAILFLNGLSSRYSQLKHTLKYGNKALSLQDVI SSAKSLERELNESLDLERSSSTVLYTTERGRPLVRNNQNNQNNQKGGQGRGRSRSNSKTRVTCWFCKKEG HVKKDCFARKKKMETEGPGEAGVIIEKLVFSEALSVNDQMVKDLWVLDSGCTSHMTSRRDWFCDFQENGS TTILLGDDHSVESQGQGSIRVNTHGGSIKILNNVKYVPNLRRNLISTGTLDKLGYQHEGGAGKVRYFKNQ VTALCGSLVNGLYILDGETVMTESCAAVDSQSKTALWHSRLGHMSLNNLKVLAGKGLLNGKEIKDLDFCE HCVMGMSKRLSFNVGKHDVVEALSYVHADLWGSSNLSPSLSGKQYFLSIIDDKTRKVWLYFLRTKDETFD KFCEWKELVENQVDRKVKCLRTNNGLEFCNTKFDRYCKTHGIERHRTCVYTPQQNGVAERMNRTIMEKVR CLLNESGLDESFWAEAAATAAYIINRSPASAIDHNVPEELWLNRKPGYKHLKRFGSIAYVHHDQGKLKPR ALKGVFLGYPAGTKGYKIWLLDERKCVISRNVIFREDMVYKDLNKDVNDAVAEDAEASTSNSDVISELVK KRVSSKQGGVTTELVEVSESESEEDSEEPAETAVTQSPEPSGLTNYQLARDRTRRQIVAPVKMKDYSQFA FALMTYEILNVEEEPQCLHDAQKDENWELWNGAIGEEMDSLTKNGTWELVDRPKDRKVISCRWLFKIKVG IPGVESKRYKARLVARGFSQKKGIDYQEIFALVVKHTSIRGLMFVVVNLDLELEHMDVKTAFLHGELEEE LYMEQPEGVVSVGNEDKVFLLKKSLYGLKQAPRQWNKRFNKFMTDEKFQRSDHDQCVYVKTMNNGELVYL LLYVDDMLIAAKNMSEVNKVKKRLSSEFEMKDMGPANKILGIEITRDRVNGVLCLSQAGYLKKVLKRFNM SNCKSALTPIGTHFKLASVQDDSECIDTVKTPYSSAVGSVMYAMISTRPDLAYAIGLVSRFMSKPGSVHW EAVKWLLRYIKGSHDLSLVYTKGKDLSVIGYCDSDHGGDLDRKRFTSGYVFTVGGNTISWKSCLQSVVAL SSTEAEFIALTEAVKEAIWVKGLLEDLGFQQDKAQVWSDSQSAICLSRNSVFHERTKHMARKRSFLSDII EEGNIEVVKIHTSINPADMLTKCIPVKSFDSALDTLKLIEWK
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute