Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 18

ATCOPIA65_I

Internal region of ATCOPIA65 copia-like LTR-retrotransposon.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA65LTR; ATCOPIA65_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA65 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(2) p. 18 (2001)
Abstract:
ATCOPIA65_I is an internal region of the ATCOPIA65 copia-like endogenous retrovirus flanked by the 1% divergent ATCOPIA65LTR long terminal repeats, and by a 5-bp target-site duplication. ATCOPIA65_I encodes well preserved remnants of the 1374-aa copia-like polyprotein ATCOPIA65p. ATCOPIA65p: MSEIVEATSKGKEGGGSASIQCPMLNSVNYTVWTMRMEAVLRVHKLWGTIEPGSADEEKNDMARALLFQS IPESLILQVGKQKTSSAVWEAIKSRNLGAERVKEARLQTLMAEFDKLKMKDSETIDDYVGRISEITTKAA ALGEDIEESKIVKKFLKSLPRKKYIHIVAALEQVLDLKTTTFEDIAGRIKTYEDRVWDDDDSHEDQGKLM CVKTXSQDGKLMYANSDSQGQYEFQDRGRGRGRGRFGRGRGRGYQQRDKSKVTCYRCDRLGHYASDCPDR LLKLIRLQEQKEKEEDDTHEAESLMMHEVVYLNEKNIRPTELESCINNAWYLDNGASNHMTGNRAWFCKL DEMITGKVRFGDDSCINIKGKGSIPFISKGGERKILFDVYYIPDLKSNILSLGQATESGCDIRMREDYLT LHDREGNLLIKAQRSRNRLYKVSLEVENSKCLQLTTTNESTIWHARLGHISFETIKAMIKKELVIGISSS VPQEKETCGSCLFGKQARHSFPKATSYRAAQVLELIHGDLCGPISPSTAAKKRYVFVLIDDHSRYMWSIL LKEKSEAFGKFKEFKALVEQECGAIIKTFRTDRGGEFLSHEFQEFCAKEGINRHLTAPYTPQQNGVVERR NRTLLGMTRSILKHMNMPNYLWGEAVRHSTYLINRVGTRSLSNQTPYEVFKHKKPNVEHLRVFGCVSYAK VEVPNLKKLDDRSRMLVYLGTEPGSKAYRLLDPTKRRIFVSRDVVFDENRSWMWQESSSETDKESGTFTI TLSEFGNNGVTENDISTEPEETEEAEINGEDENIIEEAETEEHDQSQEEPQPVRRSQRQVIRPNYLKDYV LCAEIEAEHLLLAVNDEPWDFKEANKSKEWRDACKEEIQSIEKNRTWSLVDLPVGSKAIGVKWVFKLKHN SDGSINKYKARLVAKGYVQRHGVDFEEVFAPVARIETVRLIIALAASNGWEIHHLDVKTAFLHGELREDV YVSQPEGFTNKESKEKVYKLHKALYGLRQAPRAWNTKLNEILKELKFEKCHKEPSLYRKQEGENILVVAV YVDDLLVTGSNLDIILNFKKGMVGKFEMSDLGKLTYYLGIEVLQSKDGITLKQERYAKKILEEAGMSKCN TVNTPMIASLELSKAQDEKRIDETDYRRNIGCLRYLLHTRPDLSYNVGILSRYLQEPRESHGAALKQILR YLQGTTSHGLYFKKGENAGLIGYSDSSHNVDLDDGKSTGGHIFYLNDCPITWCSQKQQVVTLSSCEAEFM AATEAAKQAIWLQELLAEVIGTECEKVTIRVDNKSAIALTKNPVFHGRSKHIHRRYHFIRECVENGQIEV EHVPGVRQKADILTKALGKIKFLEMRELIGVQGVSKEDFKLKRE
Derived:
Positions 13692 17856 Accession No AB025639 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute