Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 12

ATCOPIA63_I

Internal region of ATCOPIA63 copia-like LTR-retrotransposon.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA63LTR; ATCOPIA63_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA63 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(2) p. 12 (2001)
Abstract:
ATCOPIA63_I is an internal region of the ATCOPIA63 copia-like endogenous retrovirus flanked by the identical ATCOPIA63LTR long terminal repeats, and by a 5-bp target-site duplication. ATCOPIA63_I encodes the 1348-aa copia-like polyprotein ATCOPIA63p. ATCOPIA63p: METTMQQVIPIFNGESYGFWKIKMITILKTRKLWDVIENGVTSNSSPETSPALTRERDDQVMKDMMALQI LQSAVSDSIFPRIAPASSATEAWNALEMEFQGSSQVKMINLQTLRREYENLKMEEGETINDFTTKLINLS NQLRVHGEEKSDYQVVQKILISVPQQFDSIVGVLEQTKDLSTLSVTELIGTLKAHERRLNLREDRINEGA FNGEKLGSRGENKQNKIRHGKTNMWCGVCKRNNHNEVDCFRKKSESISQRGGSYERRCYVCDKQGHIARD CKLRKGERAHLSIEESEDEKEDECHMLFSAVEEKEISTIGEETWLVDSGCTNHMSKDVRHFIALDRSKKI IIRIGNGGKVVSEGKGDIRVSTNKGDHVIKDVLYVPELARNLLSVSQMISNGYRVIFEDNKCVIQDLKGR KILDIKMKDRSFPIIWKKSREETYMAFEEKEEQTDLWHKRFGHVNYDKIETMQTLKIVEKLPKFEVIKGI CAACEMGKQSRRSFPKKSQSNTNKTLELIHSDVCGPMQTESINGSRYFLTFIDDFSRMTWVYFLKNKSEV ITKFKIFKPYVENQSESRIKRLRTDGGGEFLSREFIKLCQESGIHHEITTPYSPQQNGVAERRNRTLVEM ARSMIEEKKLSNKFWAEAIATSTYLQNRLPSKSLEKGVTPMEIWSGKKPSVDHLKVFGCVCYIHIPDEKR RKLDTKAKQGIFVGYSNESKGYRVFLLNEEKIEVSKDVTFDEKKTWSHDEKGERKAILSLVKINSQEQGG GNDLNAHIDQVSNAFNQLHISSRGVQNSHEEGEESVGPRGFRSINNLMDQTNEVEGEALIHEMCLMMAEE PQALEEAMKDEKWIEAMREELRMIEKNKTWEVVARPKDKNVISVKWIFRLKTDASGEAIKRKARLVARGF TQEYGVDYLETFAPVSRYDTIRTIMAIAAQQGWKLFQMDVKSAFLNGDLEEEVYIEQPPGFIEEKEEGKV LKLHKALYGLKQAPRAWYGRIDGYFIKNGFERSINDAAFYVKKTSKEILVVSLYVDDIIVTGSNVKEIER FKEEMKNEFEMTDLGELSYFLGMEVNQDDEGIFLSQENYAKKLLKKFGMQECKSVSTPLTPHGKIEEVLS EKLEDVTMYRSMIGGMLYLCASRPDIMYASSYLSRYMRSPLKQHLQEAKRVLRYVKGTLTYGIHFKRVEK PELVGFSDSDWAGSVEDKKSTSGYVFTIGSGAFCWNSSKQKTVAQSTAEAEYIAVCSAANQAIWLQRLVN EIGFKAEKGIRIFCDNKSAIAIGKNPVQHRRTKHIDIKYHFVREAQQNGKIKLEYCPGELQIADILTKPL NTTRFEVLREELGVTMKP
Derived:
Positions 66843 70913 Accession No AP002064 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute