Repbase Reports

2001, Volume 1, Issue 2
February 28, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 2

ATCOPIA48_I

Internal region of ATCOPIA48 copia-like LTR-retrotransposon.

Submitted:
28-Feb-2001
Accepted:
28-Feb-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; ATCOPIA48LTR; ATCOPIA48_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA48 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(2) p. 2 (2001)
Abstract:
ATCOPIA48_I is an internal region of the ATCOPIA48 copia-like endogenous retrovirus flanked by the 98% identical ATCOPIA48LTR long terminal repeats, and by the 5-bp target-site duplication (GAAGT). ATCOPIA48_I CDS, which encodes the ATCOPIA48p copia-like polyprotein, is interrupted by a non-LTR retrotransposon inserted recently in the genome. Presumably, the insertion has induced a 2629-bp duplication which flanks the insert. Both the non-LTR retrotransposon and a copy of the 2629-bp direct repeat were removed from the ATCOPIA48_I sequence reported here. ATCOPIA48p: MERRSMELYTVPQLNISNCVTVTLTQQNYILWKSQFESFLSGQGLLGFVTGSISAPSPTIPVPDINGVTT DRPNPEFDVWFKTDKVVKSWLLGSFAEDILSVVVNYVTAHEVWSTLANHFNRATSSRLFELQRRLQTLEK KDKPMQVYLKELQTIYEQLASVGSPVPEKMKIFAALNGLGREYEPIKTSIEGSIDIPPTPKLDEIMPRLN GYDDRLQAYAANSDVSPHLAFNTVQANSVFYTNRGRGQGNRRFGGSRGQGSFSTRGRGFHQXLSYNDSSS NASAERPTCQICGKHGHHALNCWHRFDNSYQLDVLPQALPATQITDITDHSGSEWVTDSAATAHITNSPR HLQQTKSYAGSDSVMVGNGNFLPITHTGSTSIGSTSGKLHLKDVLVCPLITKSLLSVSKVTKDYPCIFEF DCDEVRVRDKETKKLLLQGSNRDGLYVLDEPKLLVFYSSRQVAASDEVWHRRLGHPNPHVLQQLSSTKSI LINKHSKAICEACQSGKSSRLSFSASSFVASRPLERIHCDLWGPSPVMSVQGFRYYVIFIDNYSRYCWFY PLKLKSDFYTIFAKFQALVQNQLQSKISIFQCHGGGEFTSKVFLNHLQEHGIQQYISCPYTPQQNGLAER KHRHITDFGLSMLFQGKVPQKHWVEAFYTTNFLSNLLPHTALTDAKSPFELLNKKKPDYQALRIFGCACF PTLRDYAQHKFDPKSLKCVFLGYNEKYKGYRCLLPTTGRVYISRHVIFDEHSFPFSDTYMHLQPTGVTPL LSAWQQSFMPQTTASSTASATATSPFNAAEIQVSPVITSNNNTGASVLENGSSQLPIQNSSVLSTVASEE SSECTESINLLPIGNSSSSLANRTDNADTSPLQEAATETNSSTVQEAAESTTSSTMQEPASNQSTHPMIT RSKKGITKPNPRYGLLTHKVKYAEPKTVTEALKHPGWTAAMHEEYDNCTEAQTWSLVPYTSDMNVLGSKW VFRTKLNADGSLDKLKARLVAKGFDQEEGIDYLETYSHVVRSATVRMVLHVATVMDWEVKQMDVKNAFLH GDLTETVYMLQPAGFVNKEKPTHVCHLHKALYGLKQAPRAWFDKFSNYLLEFGFNCSIKDPSLFIYLKGN DLILLLLYVDDMVLTGSNSATMIKLLEDLNTQFRMKDLGQMHYFLGTQAXFHENXXCLYTLSGLFLSQQK YAEDLLTIAAMDECSPMPTPLPLQLHKVPHQEELFANPTYFRSLAGKLQYLTLTRPDLQFSVNFVCQKMH QPTVSDYNLLKRILRYVKGTLSMGIHFSKHSDFQLRVYTEKDPAFSLRAYSDSDWGGCKDTRRSTGGYCT FLGTNLISWSSKKQPTVSRSSTEAEYRSLSETAQEMTWICHLLRELGIPLPVTPELYGDNLSSVYLTANP AFHARSKHFEFDYHYVRERVALGSLVVKHIPAHQQIVDIFTKSLPYEAFCNLRFKLGVDLPPTPRLRG
Derived:
Positions 16028 11546 Accession No AL161543 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute