Repbase Reports

2001, Volume 1, Issue 1
January 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 18

ATCOPIA58_I

Internal region of the ATCOPIA58 copia-like LTR-retrotransposon - a consensus sequence.

Submitted:
31-Jan-2001
Accepted:
31-Jan-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; gag, reverse transcriptase; integrase; ribonuclease H; ATCOPIA58LTR; ATCOPIA58_I
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of the ATCOPIA58 copia-like LTR-retrotransposon - a consensus sequence.
Journal:
Repbase Reports 1:(1) p.18 (2001)
Abstract:
ATCOPIA58_I is a consensus sequence of an internal region of the ATCOPIA58 copia-like endogenous retrovirus. There are 4 copies of ATCOPIA58_I present in the genome; they are 98% identical to the consensus sequence, and are flanked by ~1% divergent ATCOPIA58LTR LTRs and 5-bp target-site duplications. ATCOPIA58_I encodes the 1021-aa ATCOPIA58p copia-like polyprotein. ATCOPIA58p: MDYPKEFVAVGKAIMLEKGNYGHWKVKMRALIRGLGKEAWIATSIGWKAPVIKGEDGEDVLKTEDQWNDA EEAKATANSRALSLIFNSVNQNQFKRIQNCESAKEAWDKLAKAYEGTSSVKRSRIDMLASQFENLSMEET ENIEEFSGKISAIASEAHNLGKKYKDKKLVKKLLRCLPSRFESKRTAMGTSLDTDSIDFEEVVGMLQAYE LEITSGKGGYSKGLALAASAKKNEIQELKDTMSMKNEIQELKDTISMMAKDFSRAMRRVEKKGFGRNQGT DRYRDRSSKRDEIQCHECQGYGHIKAECPSLKRKDLKCSECKGLGHTKFDCVGSKSKPDRSCSSESESDS NDGDSEDYIKGFVSFVGIIEEKDESSDSEADGEDEDNSADEDSDIEKDVNINEEFRKLYDSWLMLSKEKV AWLEEKLKVQELTEKLKGELTAANQKNSELTQKCSVAEEKNRELSQELSDTRKKIHMLNSGTKDLDSILA AGRVGKSNFGLGYNGAGSGTKTNFVRSEAAAPTKSQTGFRSNYDAVPARRVYQNHDHYHSRRTVTGYECY YCGRHGHIQRYCYRYAARLNKLKRQGKLYPYQGRTSKMYVRREDLYCHVAYTSIEEGIKKPWYFDSGASR HMTGSQSNLENYTSVKESKVTFGGGDKGKIKGKGDLTKAEKPQLTNVYFVEGLTANLISVSQLCDEGLTV SFNSVKCWATNEKNQNTLTGVRTGNNCYMWEEPKECLRAEKEDPVVWHQRLGHMNARSMSEIVSKEMVRG VQELKHIEKIVYDAYNQGKQIRVQHKRVVGVVERKNQTFQEMARAMIHGHGVPEKFWTEAISTACYVINH VYVRIGGTFDKLVKAFVKTMTTEFRLSMVGELKYFLGLQINQIDEGIAISQSTYAQNLVKRFDMCSSNPV ETPMSTTNLCSCCTKILWMKHMGLDYGMSFSDPLLVKCDNESAIAISKNPVQHSITKHIAIRHHFVRELV EEKQITVEHVPTEIQLADIFTKPLDLNMFVNLQKSLGIGEV Presumably, ATCOPIA58 was a semi-autonomous endogenous retrovirus. It is ~85% identical to ENDOVIR1.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    Direct submission (August 2001)

© 2001-2019 - Genetic Information Research Institute