Repbase Reports

2001, Volume 1, Issue 1
January 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

ATCOPIA49_I

Internal region of ATCOPIA49 copia-like LTR-retrotransposon - a consensus sequence.

Submitted:
31-Jan-2001
Accepted:
31-Jan-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; ATCOPIA49LTR; ATCOPIA49_I
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA49 copia-like LTR-retrotransposon - a consensus sequence.
Journal:
Repbase Reports 1:(1) p.8 (2001)
Abstract:
ATCOPIA49_I is a consensus sequence of an internal portion of the ATCOPIA49 copia-like endogenous retrovirus; there are 3 copies of ATCOPIA49_I present in the genome, they are flanked by ~2% divergent ATCOPIA47LTR, and by 5 bp-long target-site duplications. These copies are 1% divergent from the consensus sequence. ATCOPIA49_I encodes the 1361-aa ATCOPIA49p copia-like polyprotein. ATCOPIA49p: MAGTPIAIFDGSGDFSLWKTRIMAHLSVIGLKDVVIGTSSPPLTAEEEEDPEKKKKRDADDAARLERCDK AKNVIFLNVADKVLRKIELCQTAAEAWGTLDRLFMIRSLPHRVFTQLSFYTFKMQENKKIDENIDDFLKI VADLNHLQIEVTDEVQAILLLSSLPSRYDGLVETMKYSNSREKLRLDDVMVAARDKERELSQSNRSVSEG NFARGRQEGSSNNNQRNKGKGRSRSKSRDGKRVCWICGKEGHFKKQCFKWLERNKDKGSGSSSDKGEASI AKAEYDPAMVLMAEEENLFVSGNTADEWVLDTGCSFHMTPRRDWFSDFREVKSGYVKMGNDSLSQVKGIG NIRIKNSDGTQITLTEVRYMPTMSRNLISLGTLEDKGCWFKSQDGILKVVKGCSTVLKGQKRETLYILLG EAEIAESNVSEKSKDETVLWHSRLGHMSQKGMEILVKKGCLNRKVIHELKFCEDCIYGKNHRVSFPSAQH VTKEKLAYIHSDLWGSPHNPASLGNCQYFISFIDDYSRKVWIYFLKKKDEAFEKFVEWKKMVENQSDKKV KKLRTDNGLEYCNHYFEKFCKEEGIVRHKTVAYTPQQNGVAERLNRTIMDKVRSMLSESGMEKRFWAEAA ATAVYLINRSPSTATNFELPEERWTGALPDMSSLRRFGCLAYVHADQGKLNPRAKKGIFTSYPEGVKGYK VWLLEEKKCVISRNVIFREEMMYKDLKTDSQNSFYEEVMENIGEGSNQLISNITDQSITEQESVEQGGVT EEQIVNEQNQVQTETHEEEGSSSDNSTEEVDLSNYLLVRDREKRTVKLNRRYNESNMVGFAYNTEDGGKS EPKTYQEALSDQDWELWNGAMKEEISSMGKNHTWDLVDKPVNAKIIGCRWVFTRKAGIPGVEAPRFKARL VAKGFTQKEGVDYNEIFSPVVKHVSIRFMLSMVAQFDMELHQMDVKTAFLHGFLDEEILMAQPEGFEDKK YPEKVCLLKRSLYGLKQSPRQWNLRFDEFMKSIDFTRSAYDSCVYLKQQSDKSYVYLLLYVDDMLIAAKE KSSIMELKQLLGKEFEMKDLGEAQKILGMEIARDRAAGVLTLSQEGYVKKVLRSSQMDQAKPVSTPLGIH FKLRAATEKEYQEQFDRMKIVPYSNTVGSIMYSMIGTRPDLAYPVGVISRYMSRPLKDHWQAAKWVLRYM KGTEKKKLCFRKNKDFLLRGYCDSDYGGDYDNRRSITGYVFTIGGNTISWKSRQQKVVAISTTEAEYMAL TDAVKEALWLRGFSEELGFAQESVEVNCDSESVIALAKNSVHHERTKHIDIRLHFIRDIINAGLVKVVKI ASECNPADIFTKVLPVEKFEGALHMLRVTEN
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    Direct submission (August 2001)

© 2001-2019 - Genetic Information Research Institute