Repbase Reports

2001, Volume 1, Issue 1
January 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 6

ATCOPIA47_I

Internal region of ATCOPIA47 copia-like LTR-retrotransposon.

Submitted:
31-Jan-2001
Accepted:
31-Jan-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; reverse transcriptase; ATCOPIA47LTR; ATCOPIA47_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of ATCOPIA47 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(1) p.6 (2001)
Abstract:
ATCOPIA47_I is an internal region of the ATCOPIA47 copia-like endogenous retrovirus flanked by 2% divergent ATCOPIA47LTR LTRs and 5 bp-long target-site duplication. ATCOPIA47_I encodes the 1430-aa ATCOPIA47p copia-like polyprotein. ATCOPIA47p: MANQSMELYSYPVLNISNCVTVKLTERNYLLWKTQFESFLSGQNLLGFVNGATKSPDPVSAVTNIDGVVT EIPNADYSARHRSDQVVKSWILGSLSEDILEEVITESTAQQVWEGLARYFNRVSTARLFELQRKQQTMCK HDTPMIDYIKGIKNICEQLASAGSPVKEQMKFFAALNGLGREYEPIKTSIEGSMESTPAPTLDSITPRLT GFADRLKSYEVVSVTPHLVFTADAPDAGNYYQTNYSGRGNFSGKGNRGRGAYNTKGRGFHQQTTTGSSMS GENRPVCQICGKLGHPALKCWHRFNNSYQHEELPSALTAMHITEVTEHNGQEWFPDTGASAHVTNSHQHL QQSRPYNGSDAVIVGNGEFLPITHTGSTNLSSTSGKLPLKDVLVCPDIAKPLLSVSKLTRDYPCSFEFDC DGVRVHDKGTKRLLILGTSKDGLYVLKNTPIQAFYSTRQQATSDEVWHMRLGHPNPQILQYLSKINAIKI NKSSKSMCEACQLGKSSRLPFSLSTSVTTKPLQRIHYDLWGPAPIVSGQGFKYYAIFIDNYSRFCWFYPL KLKSDFFTVFINFQALVENQFSTKIQSFQCDGGGEFTSNQFVNHLQASGIKQLISCPHTPQQNGLAERKH RHIIELGLSMMFQSRIPQKYWVKAFFTANFLSNLLPSSVLDAQKSPYEVLLGNAPDYTSLRTFGCACFPT LRDYTQNKFDPRSLQCVFLGYNEKYKGYRCLLPSTGRVYISRHVLFDEQVFPFATLNKEVTSNLQTPLMQ AWQKSFQVLPTTSPQPASPLFSETDFPPLPIRIPEQSTVRSEGRSGCTTGLDPASIGNSLSLIPQRMDSS ESTSTSSEIPELAIVTQPTEESTENPAASTTTSTQTESDTPATAQHPMVTRSKSGITKPNPRYALLTHKV SYPEPKTVTSALKDPGWNGAMTEEIGNCGEAETWSLTPRTPEMHVLGCKWVFRTKLNADVSLNKLRARLV AKGFNQEEGIDYLKTYSPVVRSATVRGVLHVATIMEWEIKQMDVKNAFMHGDLTETVYMTQPAGFVDPDK PNHVCHLHKSIYGLKQSPRAWFDKFSTFLLEFGFTCSYPDPSLFIYIKNKDVILLLLYVDDMVITGNNSK ALSNLLAELNKQFRMKDLGELHYFLGIQVQNHSEGLFLSQQKYAEDLLVVAAMSDCSPMPTPLPLQIHKE SDTDDAFPDPSYFRSLAGKLQYLTLTRPDIQFAVNFVCRKMHAPSQFDFSLLRRILRYIKGTITMGITFR KDTDCTLRAYSDSDFGGCKSTVRSTGGFCTFLGSNLISWSSQKQDSVSKSSTEAEYRAMSEAASEITWLC SFLKELGIPLHETPSLYCDNLSAVYLTANPAFHNRTKLFLRHYHYVRERVALGALIVKHIPSHHQIADIF TKSLPHGPFSSLRFKLGIDSPPIPSLRGSH
Derived:
Positions 190949 195248 Accession No AL161552 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    Direct submission (August 2001)

© 2001-2019 - Genetic Information Research Institute