Repbase Reports

2001, Volume 1, Issue 1
January 31, 2001
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 2

ATCOPIA45_I

Internal region of the ATCOPIA45 copia-like LTR-retrotransposon.

Submitted:
31-Jan-2001
Accepted:
31-Jan-2001
Key Words:
LTR-retrotransposon; COPIA superfamily; internal region; copia-like polyprotein; ATCOPIA45LTR; ATCOPIA45_I
Source:
Arabidopsis thaliana
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons; Rosidae; Capparales; Brassicaceae; Arabidopsis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Internal region of the ATCOPIA45 copia-like LTR-retrotransposon.
Journal:
Repbase Reports 1:(1) p.2 (2001)
Abstract:
ATCOPIA45_I is an internal region of the ATCOPIA45 copia-like endogenous retrovirus flanked by 1% divergent ATCOPIA45LTR LTRs and 5 bp-long target-site duplication. ATCOPIA45_I encodes the 1367-aa ATCOPIA45p copia-like polyprotein (it is disrupted by two stop codons emerged after integration of ATCOPIA45 in the genome). ATCOPIA45p: MGDIVPVTNNTKEGSSSSSIQCPMLTATNYTFWTIRMTMALKVHKVWETIEEGLDDIDKNNMASALLLQS IPEALTLRVGKLKTAKKIWDAIKARNLGADRVKDARLQTLMGEFERIKMKETEKIDDFAGRLSELSTKSA DLGNDIEEPKLVKKFLNSLPRKRYIHIIAALEQVLDLNTTSFEDIVGRLKAYEERICDEEDNQDDQGKLL YANSEEKSAQNNWNPNKGKSQGGRGYGRGRGRDRFGNAQGNRDMTNVICYRCDKLGHYASDCPDRLLKLQ ETQDVKNDDTQKADALMMHEVVFLNEKNVMPNKLEASLDVDNVWYLDNGASNHMTGNLAYFGEIDERVTG KVRFGDDSRIDIKGKGSITFIAKNEERKILADVYYIPDLRSNIVSLGQATESGCDVRMRDDHLTLYDRDG KLLIKATRSRNRLYKVIMEVDDTKCLQLESLSETTKWHARLGHIGTDNLKRMMQKELVIGIPNIKVEKEM CGSCLLGKQARKPFPQATPYRATSILELLHGDLCGPITPSTVA*NRYIFVLIDDYSRYMWSLLLKEKSEA FNKFKSFKACVEQETGATIKTFRTDRGGEFVSQEFQAFCDASGIKRHLTAPYSPQQNGVVERRNRTLMEM TRSILKHMSVPNYLWGEAVRHSTYLINRVATRTLVDQTPYKVLKSKKPNVEHLRVFGCIGYAKAEAVHLR KLDDRSRMLVHLGTEPGSKGYRLLDPTRRKVIVSRDVVFDEEKRWKWNNSEDEINNVPGMFSLSFEEFGN NGIREEDDITEETEINDGENHDREAEIPTQAIETVEQ*VEPQVTLRKSVRVISKPSYLDDYVLLASIECE RLLLMINEEPWDYNEAKELQEWKKACVEEIASITKNHTWDLVDLPIGAKPIGLKWVFKLKRNSDGSVNKH KARLVAKGYVQRHGIDFDEVFAPVARIETVRLIIALAASNGWEIHHLDVKTAFLHGELKEVVYVSQPEGF VIGGSEDKVYKLNKALYGLKQAPRAWNNKLNKILMELKFTKCSKEPSLYCRRDKDELLVVVVYVDDLLVT GSNLQVILEFKEEMAKKFEMSDLGKLTYYLGIEVFQHEGGIMLKQERYANKILEETKMDDCNAVQIPMDA NLKLSKAQEEKNIDEKEYRRNIGCLRYLLHTRPDLSYCVGVLSRYMHEPKESHGAALKQILRYLRGTQSF GLCFKRMNKTELVGFSDSSHNVDEDDGRSTTGHIFYLNDCPITWCSQKQETVALSSCEAEFMAATEAAKQ AVWLQELLEEIVGKTCKQVLILIDNKSAIALTKNPVFHGRSKHIHKRYHFIRECVANEQVEVEHVPGTEQ RADILTKALGRIKFKEMRDLVGVQDMTKCSFKLKGEH
Derived:
Positions 14885 19095 Accession No AL161592 GenBank (rel. 124.0)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    Direct submission (August 2001)

© 2001-2022 - Genetic Information Research Institute