Repbase Reports

2002, Volume 2, Issue 7
July 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 24

L1-4_DR

L1-4_DR is a non-LTR retrotransposon from the L1 clade.

Submitted:
31-Jul-2002
Accepted:
31-Jul-2002
Key Words:
Non-LTR retrotransposon; endonuclease; reverse transcriptase; L1 clade; L1-4_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
L1-4_DR, a family of non-LTR L1-like retrotransposons from zebrafish.
Journal:
Repbase Reports 2:(7) p. 24 (2002)
Abstract:
L1-4_DR is a family of L1-like non-LTR retrotransposon. This family was active recently (no stop codons in ORF1; a few stop-codons in ORF2). It encodes two proteins: the 459-aa L1-4_DR1p (positions 171-1547) and the 1294-aa L1-4_DR2p (positions 1577-5461, a conceptual translation). These proteins are most close to corresponding proteins encoded by other L1-like elements. L1-4_DR1p is a putative RNA/DNA binding protein, and L1-4_DR2p is composed of the AP endonuclease (aa positions 1-200) and reverse transcriptase domains. L1-4_DR1p: MDTLVKELELKMDYGSMDKATPENNNSRDSNNGIDDNDTWATVVARRRKTKSDTSREGSGEMQQTKGKAN AEHLENSQQSSHRNEMINKLKSQARFQRQYKKETTLTMTVKDPENITVTMIIKAVEDKTGIGKLFGLRKK SNFDYELTMENETDCDHLMDGLMINQQFCEVSKLCATERMVSFLNLPNYIQDSEIIQKLVDWGVSPILPL RRRYHPGTTVADGTRFIRVKFPKEVMSLPYNVKFDTEEGPKYFRVIHDQQIKTCRLCGSAEHEKKDCPQF VCRECLEQGHFTRDCKAPRCQGCKKTILWCRCESDEEETGVMETNKQMEKSSNEEREEEVQELPPDDLNE QEEEQAMSEEDEGDTADTEAQDLMKDDGHDMEEEQGAAGENTESRIEEEVSDDDDNEEINIGTKDRTIDS INRRRRKTVQLNIQQVLKKQKLRKEAKAKLKTERTDLRF L1-4_DR2p: MDCFIWIFFCLDGLFSFIFLMNNLCLVSINVRGLSSKVKFENVIALTKKCDVICIQETGWNENIVNDLKK CWDGEILYNNDPNKKKGMAILIRRGIGYTFDVLFKDNYGRILTIKIMNKDEEIRICNIHAPNEDLERVTF FKDLSVLMSGWNNVIVLGDFNTVLERIDVDDHMVFRADVGRRELKHMIEKHKYVDVWRERNRAKREYSRR QWVNTVLKQSRLDYVLCTRNVESFISNIFYKIFSCSDHDFLYVMMDFSGVERGPGVWVFNTELLKNDFYK IEMENIIINSVNDELYDEEISVWWDNVKLEAKRFSIECSKKMQKAKRAKERQLNKEWENEMEKITEGNMD IRRIVILEEKLKKLEEEKCMGARIRSKIKNTVEGERSTKFFYDLEKTRQKADLIKNVSTKEKTVKDKESI LRTVKDFYETLFKAKGVHEEDKDFLLNQIKVKVSEEDKKLCDSDITEEEINEAITQLSNGKSPGLDGLSS EFYKTFKDVLIPILKDLFIAIFKKGQLSESMKKGMIKIIYKNKGDKDYLQNYRPLSMLNTDYKILAKILA NRLKKVVPTLITTNQAYGVIGRDIADTVTSIRDLIWYIKEKKDEGFLFSIDLEKAFDRVEHSYLFDIIQK FGFGENFIKWIKCFLYRDIFSCFKINGFLTDYMEISRSIRQGCPLSALLYTLVAEPLGLAINGEKKIKGF KIEINRTEQKIYQYADDTTLFLKDFKSVGKAMEIFDKYCRGSVAKVNKEKTEYMKMGKVDVQQGNWEYKE QKKYINILGITLGYDENKTREIIWDELINKMEKRLCFWKQRVLFLKGKVLVLNSLFLSKMWYVLSVVSLP TWVYKKLKTMILNFLWDDKPSKIAYNTIIGKVDEGGLRLIDPWIRIKSMRIKTLKKFLNEDNILWKSIMS YFINKCGQIRDDFLWMAFKDRMIENIPEFYEELLRTWKCFYNNIQTEIEGRKLYLQQPLFLNQNNKSKKQ MFYENWYAVGFRQVKDILYEIKPGFLPTQAIIDTLEEIEDVDDKEKIEDQYKKLRLALPDHWIKTIEENE KRN*K*KNKSFF*KWMKIRLVSMIVLSRCFIHVCVTLCLKKPKSREFWEKLFENFDTSNIWKNVRSILKS PALENLDFMLRHNCIMTEIIFKKIGVSQDDLCKVCLEKKEGVLHLFLNCKKLSDFMKMLKTMVCNFLYDE NIILEEWDVLFGFNGKTKNKFALNYMLTLARYTIWKRRNIMKQKKKEIPLVLLYKQIVTEEIMVIYDYCK MYEKMDIFEKCIRKNNPYIVQTWTGFKVFLPGDF
Derived:
Positions 100605 95058 Accession No AL807749 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2018 - Genetic Information Research Institute