Repbase Reports

2002, Volume 2, Issue 7
July 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 22

L1-2_DR

L1-2_DR is a non-LTR retrotransposon from the L1 clade.

Submitted:
31-Jul-2002
Accepted:
31-Jul-2002
Key Words:
Non-LTR retrotransposon; endonuclease; reverse transcriptase; L1 clade; L1-2_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
L1-2_DR, a family of non-LTR L1-like retrotransposons from zebrafish.
Journal:
Repbase Reports 2:(7) p. 22 (2002)
Abstract:
L1-2_DR is a family of L1-like non-LTR retrotransposon. This family was active recently (ORF1 and ORF2 have two stop codons only). The element is incomplete (its ~100-bp 5' terminus is deleted). It encodes two proteins: 469-aa L1-2_DR1p (positions 1-1407) and 1280-aa L1-2_DR2p (positions 1513-5353). These proteins are most close to corresponding proteins encoded by other L1-like elements. L1-2_DR1p: YIPGSVWLQLVREAHQIFFVYFCFCLKYIFVKLFFVCLVCPPSSVSCSGGVFFIYLFFFAMDGSTVTDLA MADGVEKANDNGLDRRQQETNQSEKEARKRIYLKEATVTVDIGQATEVRAIDVIKAETERIGDGKILAVR PKHNKEYEVTLEREEDADELMDELTIKGINCAVKRLQNRDYVVSFMHLPVYVADKDILDKLDHWGVCPIS KIKRRFYPGTNIEDGTRFVKTRFPKELASLPYSTRIETAEGPQYFRVMHSH*VKTCRLCLSPDHVVKDCP DFRCYKCEERGHFAKFCTAVKCPDCNKVLNKCECWIGEEEEEVEQQVGRQMYEGDNIQSEDKTTTQEKST ESESEKLQENETNGIDRVTEQEGTTWTQMDMTDSLKSVLEAAELSDSNNKDLNQGQQEDTFWTQMDITDS FQKALDTEETKGQSNDEQADLEGHLQKDGNKETQGKSAKRRRSLKINLI L1-2_DR2p: MNVFMSFMNVFIFFMVLGIVSFNARGLLDIRKFEKVKEMCKREDVILLQETNWREECMKEIRKRWSGEML YNNGDGRLGRGVAILLKENSGVLCKTIYNDKEGKCMICEMEYVKKKVIMVNVHAPTEENKKKEYYNVLRD YLKKHERVIIMGDFNTVFSKLEMAEGMVFKTDKGRKELKILMEEMNLIDVWRERNEQTKEYSRRQIVGNF CCQTRIDFILCTRNVEGFINKIKYEETSLSDHKPLFMKLDWSNVKRGPGVWVLNTAVLKNEDYVLSVKEI IQKEKGNEIYNEDKRMWWENVKYLVKKFTIKYCRQLQNCKKYKEKELKEKLENELKNENGKNIQKIKELQ GRLNEMEEEKFEGARLRSKAKFTVEGEKCTKFFFDLEKRRGKSEMIREIRSKNGNVVEQHEEILEEIRSY YEKLFCTEGIKEKEKGELLNLIKSRVEEGEKRECDEEIREEEIKRAISGLNKKKSPGIDGLGSEFYIVFK DILSSILKEVYDEIFENGEINKRMGMGLMKVIYKGKGDKVDLKNYRPITMLNTDLKILAKVLANRLKEVM PSIIKTNQAYSIKGRDIADTTMSIKDTIRYINDKQKDGFLISLDFEKAFDRVEHDFLFGVLKSFGFGENF IKWVQILYRGAVTRIKCNGFLTDCFKIRRSIRQGCPLSALLYALVAEPLGLAVKHEDRIKGIEVEGGVNK IFQYADDTTLILQDLASVKQAMETVQHFCKGSGAKINENKTGYLRFGRTEALSGHFTFKEMDEIKILGIV IGRDEKKAEVTMWEEILGGIERRLRFWKLMSLTLKGRVLILSVLMVSKLWNILYVSSMPLWMEKRLKQCF LDFLWEGKPPRIAYATLIGEVGKGGLGLIDVEQRKNSLRVKMVRKYLDEDNKAAWKRTMEYFLSKSGNFN MGDNILYMRMKKFMTEGLPDFYKELIGAWGKFLTCVHFNIQGRENILNQPLFLNSGILNQEKVVFFRKWW EVGITRVRDVLYEFKEGFLPVQYVIDVMDEAKEDFNRQDLIKEYDIIKNAIPAEWLTRIENMEENKQSKD VIVRFGEKWWNLKDSTVKMIYGFFRDGVFKKPRANENWIRMFKDVNEDNIWANIKGKLVQSKVENLEYLI RNKAVFTDIILNKIGMEESVTCKVCQDADEGFLHLFLYCNELKDFNEKCKSIILTLKGERDDELEWEKVL MLGVNKECNNEKLINLLVMLRKSAIWERRVAAKKEKAVLDVWNVFKRKVEKYVECLFYYFKLEDMQEAFY DVFTQEVSKILNDTGMKMPF
Derived:
Positions 96682 91187 Accession No AL645691 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2018 - Genetic Information Research Institute