Repbase Reports |
|---|
| 2002, Volume 2, Issue 10 |
| October 31, 2002 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 2 |
BS4_DM |
|||
|---|---|---|---|
BS4_DM is a non-LTR retrotransposon - a partial consensus sequence. |
|||
|
Submitted: 31-Oct-2002 |
Accepted: 31-Oct-2002 |
||
|
Key Words: Non-LTR retrotransposon; ORF2; reverse transcriptase; JOCKEY clade; BS; BS4_DM |
|||
|
Source: consensus |
Organism: Drosophila melanogaster |
Taxonomy: Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: BS4_DM, a family of non-LTR retrotransposons from the Jockey clade. |
|||
|
Journal: Repbase Reports 2:(10) p. 2 (2002) |
|||
Abstract: BS4_DM belongs to the JOCKEY clade of non-LTR retrotransposons. BS4_DM is a family of retrotransposons that were active in the D. melanogaster genome a few million years ago. Two copies of BS4_DM are present in the sequenced genome, they are 7% divergent from each other. There is a 68% nucleotide identity between BS4_DM and BS. Protein sequences encoded by these elements are also 68% identical to each other. Therefore, a strong stabilizing selection was channeling evolution of these non-LTR retrotransposons. BS4_DM encodes BS4_DMp, a portion of the reverse transcriptase. BS4_DMp: SYLDGRKLMVRYTDTYSAPCQMLAGVPQGSVLGPLLYSLYTADLPRPTYENAQYPSKAIIATYADDIAVL YRSKCRIEAANGLQGYLQTLSAWSRRWNMKVNPLKTFNPCFTLKRLATPAIQFEGVTLEQPSQAKYLGIT LDKRLTFGPHIKTITKRCGQRMQHLRWLINKRSTMSLRAKRAVYVDCIAPTD Approximately, a 4-kb 5' portion is missing in the current version of the BS4_DM consensus sequence.
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||